Query         gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 41
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 16:07:25 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780555.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2z2n_A Virginiamycin B lyase;  40.9      20  0.0006   18.9   2.5   20   10-29     14-33  (89)
  2 >2jwk_A Protein TOLR; periplas  33.6      30 0.00089   18.0   2.4   17   12-28      3-19  (74)
  3 >1n10_A PHL P I, pollen allerg  29.1      43  0.0013   17.2   2.6   28   12-39      3-33  (98)
  4 >3dmq_A RNA polymerase-associa  27.2      19 0.00055   19.1   0.4   16    9-24     87-102 (119)
  5 >2eel_A Cell death activator C  25.9      40  0.0012   17.3   2.0   19    5-23     39-57  (91)
  6 >3c0w_A Intron-encoded endonuc  25.5     6.3 0.00019   21.6  -2.2   11   21-31      1-11  (59)
  7 >2z2n_A Virginiamycin B lyase;  24.2      59  0.0017   16.4   2.5   19    9-27     42-60  (84)
  8 >1ulz_A Pyruvate carboxylase N  24.1      62  0.0018   16.3   2.7   18   13-30     97-114 (148)
  9 >2jnz_A PHL P 3 allergen; timo  23.7      73  0.0022   15.9   3.4   30   10-39     11-43  (108)
 10 >2qe8_A Uncharacterized protei  22.9      59  0.0017   16.4   2.4   18   11-28     49-66  (98)

No 1  
>>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, enzyme mechanism, virginiamycin B hydrolase, streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* (A:1-55,A:266-299)
Probab=40.92  E-value=20  Score=18.89  Aligned_cols=20  Identities=25%  Similarity=0.664  Sum_probs=15.8

Q ss_pred             CCCCEEEEEECCCCEEEEEE
Q ss_conf             56828999917998999982
Q gi|254780555|r   10 EHNPIRIVVDEDGNYWFMVK   29 (41)
Q Consensus        10 ehnpirivvdedgnywfmvk   29 (41)
                      .-.|=-+.+|++||+|+-.-
T Consensus        14 ~G~PDGmavDadGnLWVA~~   33 (89)
T 2z2n_A           14 DTGPYGITVSDKGKVWITQH   33 (89)
T ss_dssp             SCCEEEEEECTTSCEEEEET
T ss_pred             CCCCEEEEECCCCCEEEEEC
T ss_conf             99955799999998999977


No 2  
>>2jwk_A Protein TOLR; periplasmic domain, membrane, inner membrane, protein transport, transmembrane, transport, membrane protein; NMR {Haemophilus influenzae} PDB: 2jwl_A (A:)
Probab=33.63  E-value=30  Score=17.97  Aligned_cols=17  Identities=24%  Similarity=0.389  Sum_probs=15.0

Q ss_pred             CCEEEEEECCCCEEEEE
Q ss_conf             82899991799899998
Q gi|254780555|r   12 NPIRIVVDEDGNYWFMV   28 (41)
Q Consensus        12 npirivvdedgnywfmv   28 (41)
                      .||.|.+|.||+||+-.
T Consensus         3 ~pi~VsI~~dG~~~i~~   19 (74)
T 2jwk_A            3 VPVILEVAGIGKYAISI   19 (74)
T ss_dssp             SCEEEEECSSSCEEEEE
T ss_pred             CCEEEEEECCCCEEEEC
T ss_conf             89899991793289953


No 3  
>>1n10_A PHL P I, pollen allergen PHL P 1; plant allergen, expansin, immunoglobulin-like fold, double-PSI beta barrel, structural genomics; HET: NAG; 2.90A {Phleum pratense} (A:144-241)
Probab=29.08  E-value=43  Score=17.17  Aligned_cols=28  Identities=25%  Similarity=0.388  Sum_probs=18.4

Q ss_pred             CCEEEEEECCCC-EEEE--EEECCCCCEEEE
Q ss_conf             828999917998-9999--821247602212
Q gi|254780555|r   12 NPIRIVVDEDGN-YWFM--VKDVAGGLDFTS   39 (41)
Q Consensus        12 npirivvdedgn-ywfm--vkdvaggldfts   39 (41)
                      .-||+-|+|.+| |||+  |+.++|.-|..+
T Consensus         3 g~i~F~V~~gsnp~~l~vlv~nvgG~gdV~~   33 (98)
T 1n10_A            3 TKVTFHVEKGSNPNYLALLVKYVNGDGDVVA   33 (98)
T ss_dssp             CCCEEEECTTCBTTEEEEEEECCCCSSCEEE
T ss_pred             CEEEEEECCCCCCCEEEEEEEEECCCCCEEE
T ss_conf             5599997558886438999998589875899


No 4  
>>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} (A:115-149,A:785-851,A:952-968)
Probab=27.15  E-value=19  Score=19.09  Aligned_cols=16  Identities=38%  Similarity=0.812  Sum_probs=13.2

Q ss_pred             CCCCCEEEEEECCCCE
Q ss_conf             2568289999179989
Q gi|254780555|r    9 LEHNPIRIVVDEDGNY   24 (41)
Q Consensus         9 lehnpirivvdedgny   24 (41)
                      |--.|||+++|+.||-
T Consensus        87 LP~tpiRiLlD~~G~d  102 (119)
T 3dmq_A           87 LPPTPVRXLLDKNGNN  102 (119)
T ss_dssp             CCSCCCCCEESSSSCB
T ss_pred             CCCCCEEEEECCCCCC
T ss_conf             6774417897587553


No 5  
>>2eel_A Cell death activator CIDE-A; CIDE-N domain, cell death- inducing DFFA-like effector A, structural genomics, NPPSFA; NMR {Homo sapiens} (A:)
Probab=25.88  E-value=40  Score=17.32  Aligned_cols=19  Identities=21%  Similarity=0.455  Sum_probs=15.4

Q ss_pred             CCCCCCCCCEEEEEECCCC
Q ss_conf             0100256828999917998
Q gi|254780555|r    5 IPFNLEHNPIRIVVDEDGN   23 (41)
Q Consensus         5 ipfnlehnpirivvdedgn   23 (41)
                      .-|++.-.+++||.+|||.
T Consensus        39 ~kl~l~~~~~~lvLeeDGT   57 (91)
T 2eel_A           39 DALVIATGLVTLVLEEDGT   57 (91)
T ss_dssp             HHTTCSSSCEEEEETTTCC
T ss_pred             HHHCCCCCCCEEEEECCCC
T ss_conf             9858998677899938997


No 6  
>>3c0w_A Intron-encoded endonuclease I-SCEI; endonuclease, homing, ladlidadg, catalytic mechanism, metal binding; HET: DNA; 2.20A {Saccharomyces cerevisiae} PDB: 1r7m_A* 3c0x_A* (A:145-203)
Probab=25.48  E-value=6.3  Score=21.58  Aligned_cols=11  Identities=36%  Similarity=0.646  Sum_probs=7.1

Q ss_pred             CCCEEEEEEEC
Q ss_conf             99899998212
Q gi|254780555|r   21 DGNYWFMVKDV   31 (41)
Q Consensus        21 dgnywfmvkdv   31 (41)
                      ||.||+|-.--
T Consensus         1 ~~~YWiMDDGs   11 (59)
T 3c0w_A            1 DGGKWDYNKNS   11 (59)
T ss_dssp             HEEESCCSTTC
T ss_pred             CCCEECCCCCC
T ss_conf             98302145568


No 7  
>>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, enzyme mechanism, virginiamycin B hydrolase, streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* (A:182-265)
Probab=24.21  E-value=59  Score=16.45  Aligned_cols=19  Identities=21%  Similarity=0.448  Sum_probs=14.3

Q ss_pred             CCCCCEEEEEECCCCEEEE
Q ss_conf             2568289999179989999
Q gi|254780555|r    9 LEHNPIRIVVDEDGNYWFM   27 (41)
Q Consensus         9 lehnpirivvdedgnywfm   27 (41)
                      ....|-.|.+|.||++|+-
T Consensus        42 ~~~~P~gia~d~~G~i~v~   60 (84)
T 2z2n_A           42 PNARPHAITAGAGIDLWFT   60 (84)
T ss_dssp             TTCCEEEEEECSTTCEEEE
T ss_pred             CCCCEEEEEECCCCCEEEE
T ss_conf             5771267999999819999


No 8  
>>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase, ligase; 2.20A {Aquifex aeolicus VF5} (A:105-132,A:204-323)
Probab=24.11  E-value=62  Score=16.31  Aligned_cols=18  Identities=22%  Similarity=0.726  Sum_probs=12.3

Q ss_pred             CEEEEEECCCCEEEEEEE
Q ss_conf             289999179989999821
Q gi|254780555|r   13 PIRIVVDEDGNYWFMVKD   30 (41)
Q Consensus        13 pirivvdedgnywfmvkd   30 (41)
                      -+...+|+||+++|+--.
T Consensus        97 tvEFl~d~dg~~YflEvN  114 (148)
T 1ulz_A           97 TMEFIADQEGNLYFIEMN  114 (148)
T ss_dssp             EEEEEECTTCCEEEEEEE
T ss_pred             EEEEEECCCCCEEEEEEC
T ss_conf             057998279977888612


No 9  
>>2jnz_A PHL P 3 allergen; timothy grass pollen; NMR {Phleum pratense} (A:)
Probab=23.71  E-value=73  Score=15.93  Aligned_cols=30  Identities=10%  Similarity=0.161  Sum_probs=20.6

Q ss_pred             CCCCEEEEEECCCC-EEEE--EEECCCCCEEEE
Q ss_conf             56828999917998-9999--821247602212
Q gi|254780555|r   10 EHNPIRIVVDEDGN-YWFM--VKDVAGGLDFTS   39 (41)
Q Consensus        10 ehnpirivvdedgn-ywfm--vkdvaggldfts   39 (41)
                      .--+|++-++|..| |||+  |+.++|.-|..+
T Consensus        11 pcg~i~f~v~~GSnp~~~av~V~n~~g~gdI~~   43 (108)
T 2jnz_A           11 SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAE   43 (108)
T ss_dssp             CCCEEEEEECTTCCSSEEEEEEEEEBTTBCEEE
T ss_pred             CEEEEEEEECCCCCCCEEEEEEEECCCCCCEEE
T ss_conf             506699999799996759999998279987999


No 10 
>>2qe8_A Uncharacterized protein; YP_324691.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} (A:19-116)
Probab=22.92  E-value=59  Score=16.43  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.5

Q ss_pred             CCCEEEEEECCCCEEEEE
Q ss_conf             682899991799899998
Q gi|254780555|r   11 HNPIRIVVDEDGNYWFMV   28 (41)
Q Consensus        11 hnpirivvdedgnywfmv   28 (41)
                      .+..++++|++|..|.+=
T Consensus        49 ~sV~~v~iD~~~rLWvlD   66 (98)
T 2qe8_A           49 DTVLGIKSDGNGIVWXLD   66 (98)
T ss_dssp             SCEEEEEECSSSEEEEEE
T ss_pred             CCCEEEEECCCCCEEEEE
T ss_conf             683389998999999970


Done!