BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] gi|254040232|gb|ACT57028.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 87.0 bits (214), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT Sbjct: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|254039802|gb|ACT56598.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|317120696|gb|ADV02519.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] gi|317120739|gb|ADV02561.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120800|gb|ADV02621.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120840|gb|ADV02661.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] Length = 262 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS + PF E N IR +VD+D N WF+ KDVA L + Sbjct: 1 MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37 >gi|53803190|ref|YP_115046.1| hypothetical protein MCA2642 [Methylococcus capsulatus str. Bath] gi|53756951|gb|AAU91242.1| conserved domain protein [Methylococcus capsulatus str. Bath] Length = 252 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++IPF+ E P+R+V D G WF+ DVA L++ Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVAQSLEY 38 >gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496315|gb|ADR52914.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Score = 42.4 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS++IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSNIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495348|gb|ADR51947.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 41.6 bits (96), Expect = 0.032, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 23/37 (62%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS +IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSSIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|255020306|ref|ZP_05292374.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] gi|254970226|gb|EET27720.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] Length = 257 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++IPF+ E P+R+V D G WF+ DV L+ + T Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVCAVLELPNTT 42 >gi|9107730|gb|AAF85322.1|AE004059_12 phage-related protein [Xylella fastidiosa 9a5c] Length = 530 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 199 >gi|77747608|ref|NP_299802.2| hypothetical protein XF2524 [Xylella fastidiosa 9a5c] Length = 504 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|15837286|ref|NP_297974.1| hypothetical protein XF0684 [Xylella fastidiosa 9a5c] gi|9105566|gb|AAF83494.1|AE003912_6 phage-related protein [Xylella fastidiosa 9a5c] Length = 503 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|28199601|ref|NP_779915.1| hypothetical protein PD1726 [Xylella fastidiosa Temecula1] gi|77747679|ref|NP_779339.2| hypothetical protein PD1133 [Xylella fastidiosa Temecula1] gi|28057716|gb|AAO29564.1| phage-related protein [Xylella fastidiosa Temecula1] Length = 503 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|182681747|ref|YP_001829907.1| prophage antirepressor [Xylella fastidiosa M23] gi|182682342|ref|YP_001830502.1| prophage antirepressor [Xylella fastidiosa M23] gi|28057123|gb|AAO28988.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631857|gb|ACB92633.1| prophage antirepressor [Xylella fastidiosa M23] gi|182632452|gb|ACB93228.1| prophage antirepressor [Xylella fastidiosa M23] gi|307578623|gb|ADN62592.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] gi|307580176|gb|ADN64145.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 535 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 167 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 205 >gi|71276718|ref|ZP_00652986.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71276734|ref|ZP_00653001.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900867|ref|ZP_00682983.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71902520|ref|ZP_00684445.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162461|gb|EAO12196.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71162476|gb|EAO12210.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71727755|gb|EAO30023.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71729338|gb|EAO31453.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 370 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L +T+ Sbjct: 1 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 39 >gi|273810427|ref|YP_003344898.1| Bro-N family protein [Xylella phage Xfas53] gi|257097802|gb|ACV41108.1| Bro-N family protein [Xylella phage Xfas53] Length = 431 Score = 40.4 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 180 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 218 >gi|71898928|ref|ZP_00681095.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71731340|gb|EAO33404.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 387 Score = 40.4 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 137 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 175 >gi|169633393|ref|YP_001707129.1| hypothetical protein ABSDF1750 [Acinetobacter baumannii SDF] gi|169152185|emb|CAP01089.1| hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 260 Score = 40.4 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFIAADVATVLGY 37 >gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495367|gb|ADR51966.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496335|gb|ADR52934.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|184157378|ref|YP_001845717.1| prophage antirepressor [Acinetobacter baumannii ACICU] gi|183208972|gb|ACC56370.1| Prophage antirepressor [Acinetobacter baumannii ACICU] Length = 250 Score = 39.7 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ FN N IR V+ +DG WF+ DVA L+++ Sbjct: 1 MSNISVFNFNQNEIRTVLKDDGEIWFVASDVATVLEYS 38 >gi|283852564|ref|ZP_06369831.1| prophage antirepressor [Desulfovibrio sp. FW1012B] gi|283572012|gb|EFC20005.1| prophage antirepressor [Desulfovibrio sp. FW1012B] Length = 323 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 24/37 (64%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S+ +PF E + IR V++ DGN WF+ +DV ++ + Sbjct: 13 SNPVPFAFESHEIRTVINGDGNPWFVARDVCAAMNIS 49 >gi|15838264|ref|NP_298952.1| hypothetical protein XF1663 [Xylella fastidiosa 9a5c] gi|9106723|gb|AAF84472.1|AE003992_8 phage-related protein [Xylella fastidiosa 9a5c] Length = 381 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L + + Sbjct: 12 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYAN 50 >gi|71901490|ref|ZP_00683577.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71728746|gb|EAO30890.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 412 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L + + Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYAN 199 >gi|330810751|ref|YP_004355213.1| phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327378859|gb|AEA70209.1| Putative phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 283 Score = 38.5 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + +IPF+ + IR++ DE G+ WF+ +DVA L + Sbjct: 28 NSVIPFDFDGGAIRVITDELGDPWFVARDVADALGY 63 >gi|169634092|ref|YP_001707828.1| hypothetical protein ABSDF2615 [Acinetobacter baumannii SDF] gi|169152884|emb|CAP01922.1| conserved hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 94 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFVAADVATVLGY 37 >gi|144898901|emb|CAM75765.1| BRO, N-terminal [Magnetospirillum gryphiswaldense MSR-1] Length = 300 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M++++PF E + IR VVD DG WF+ KDVA L + + T Sbjct: 1 MTNIVPFEFEGSAIR-VVDIDGAPWFVGKDVAERLGYANAT 40 >gi|108763205|ref|YP_630118.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] gi|108467085|gb|ABF92270.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] Length = 270 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + F+ E + +R+V D G +WF+ KD+A L++ Sbjct: 1 MNQPVAFDFESHHVRVVTDAHGEHWFVAKDIAESLEY 37 >gi|28198899|ref|NP_779213.1| hypothetical protein PD1001 [Xylella fastidiosa Temecula1] gi|182681602|ref|YP_001829762.1| prophage antirepressor [Xylella fastidiosa M23] gi|28056997|gb|AAO28862.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631712|gb|ACB92488.1| prophage antirepressor [Xylella fastidiosa M23] gi|307580036|gb|ADN64005.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 262 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ M PF E + +R VVD+ G WF+ DVA L + + Sbjct: 12 MNAMTPFQFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 50 >gi|258543092|ref|YP_003188525.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256634170|dbj|BAI00146.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256637230|dbj|BAI03199.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-03] gi|256640282|dbj|BAI06244.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-07] gi|256643339|dbj|BAI09294.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-22] gi|256646394|dbj|BAI12342.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-26] gi|256649447|dbj|BAI15388.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-32] gi|256652433|dbj|BAI18367.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655491|dbj|BAI21418.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-12] Length = 234 Score = 38.1 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++IPFN E + +R V+ DG WF++ DV L+ T+ Sbjct: 1 MSNIIPFNFEDHAVR-VITRDGEPWFVLADVCDVLEHTN 38 >gi|312962012|ref|ZP_07776509.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] gi|311283822|gb|EFQ62406.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] Length = 283 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 25/37 (67%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S +IPF+ + IR++ D+ G+ WF+ +DVA L ++ Sbjct: 28 SAVIPFDFDGAAIRVITDKLGDPWFVARDVADALGYS 64 >gi|222112392|ref|YP_002554656.1| prophage antirepressor [Acidovorax ebreus TPSY] gi|221731836|gb|ACM34656.1| prophage antirepressor [Acidovorax ebreus TPSY] Length = 252 Score = 37.4 bits (85), Expect = 0.63, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +R+ VD+ G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRVQVDDQGQPWFNATDVCDALE 36 >gi|71276717|ref|ZP_00652985.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900866|ref|ZP_00682982.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162475|gb|EAO12209.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71729337|gb|EAO31452.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 264 Score = 37.4 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + + Sbjct: 5 IIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAATS 41 >gi|71899743|ref|ZP_00681894.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730438|gb|EAO32518.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 203 Score = 37.4 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + Sbjct: 5 IIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAETS 41 >gi|71899745|ref|ZP_00681896.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730440|gb|EAO32520.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 251 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E + +R VVD+ G WF+ DVA L + + Sbjct: 1 MNAITPFHFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 39 >gi|170720501|ref|YP_001748189.1| prophage antirepressor [Pseudomonas putida W619] gi|169758504|gb|ACA71820.1| prophage antirepressor [Pseudomonas putida W619] Length = 256 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 ++IPFN + IR+V D WF+ KD+A L ++ Sbjct: 2 NLIPFNFNGHEIRVVKDHANEPWFVAKDIADDLGYS 37 >gi|292491104|ref|YP_003526543.1| BRO domain protein [Nitrosococcus halophilus Nc4] gi|291579699|gb|ADE14156.1| BRO domain protein [Nitrosococcus halophilus Nc4] Length = 316 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M+D+IPFN + + IR+V+ DG WF+ KD+ L+ Sbjct: 1 MNDLIPFNFDGHDIRVVMI-DGEPWFVAKDLCDVLE 35 >gi|160898695|ref|YP_001564277.1| prophage antirepressor [Delftia acidovorans SPH-1] gi|160364279|gb|ABX35892.1| prophage antirepressor [Delftia acidovorans SPH-1] Length = 270 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 25/38 (65%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ PF + + I ++ ++ G WF+ K+V+G L ++ Sbjct: 1 MSNITPFKFQDHEITVLTNDSGEPWFIAKEVSGVLGYS 38 >gi|310286594|ref|YP_003937852.1| phage anti-repressor protein [Bifidobacterium bifidum S17] gi|309250530|gb|ADO52278.1| putative phage anti-repressor protein [Bifidobacterium bifidum S17] Length = 260 Score = 35.0 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 23/36 (63%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++ PF+ + N +RI+ D+ G WF+ KDV L + Sbjct: 4 NNLQPFDFKGNQVRILTDKKGEPWFVAKDVCNVLGY 39 >gi|190573874|ref|YP_001971719.1| putative phage-like protein [Stenotrophomonas maltophilia K279a] gi|190011796|emb|CAQ45416.1| putative phage-related protein [Stenotrophomonas maltophilia K279a] Length = 253 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +RI VD G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRIQVDGAGLPWFNASDVCNALE 36 >gi|294789953|ref|ZP_06755172.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] gi|294482110|gb|EFG29818.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] Length = 283 Score = 34.3 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 10 EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 E++ IR + DE G +WF+ DV G L + + Sbjct: 23 ENHSIRTIADEKGEFWFLANDVCGVLGYVN 52 >gi|307544693|ref|YP_003897172.1| prophage antirepressor [Halomonas elongata DSM 2581] gi|307216717|emb|CBV41987.1| prophage antirepressor [Halomonas elongata DSM 2581] Length = 262 Score = 34.3 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M + PFN + +R++ +DG F+ KDVA L + Sbjct: 1 MQSIQPFNFDSQQVRVIQGDDGEPMFVAKDVAAALGY 37 >gi|323517747|gb|ADX92128.1| prophage antirepressor [Acinetobacter baumannii TCDC-AB0715] Length = 253 Score = 33.9 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 24/41 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M+++ FN +R +V +DG WF++ DV L+ +++ Sbjct: 1 MNNVSVFNFNQKEVRTIVKKDGEIWFVLSDVCNVLEIGNVS 41 Searching..................................................done Results from round 2 >gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] gi|254040232|gb|ACT57028.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 72.7 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT Sbjct: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|254039802|gb|ACT56598.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|317120696|gb|ADV02519.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] gi|317120739|gb|ADV02561.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120800|gb|ADV02621.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120840|gb|ADV02661.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] Length = 262 Score = 72.4 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS + PF E N IR +VD+D N WF+ KDVA L + Sbjct: 1 MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37 >gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496315|gb|ADR52914.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Score = 59.6 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS++IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSNIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495348|gb|ADR51947.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 59.6 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 23/37 (62%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS +IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSSIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495367|gb|ADR51966.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Score = 54.6 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496335|gb|ADR52934.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Score = 54.6 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|9107730|gb|AAF85322.1|AE004059_12 phage-related protein [Xylella fastidiosa 9a5c] Length = 530 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 199 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 281 ITPFQFESKDVRIQLDEASAPWFNANDVCAVLEF 314 >gi|77747608|ref|NP_299802.2| hypothetical protein XF2524 [Xylella fastidiosa 9a5c] Length = 504 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 255 ITPFQFESKDVRIQLDEASAPWFNANDVCAVLEF 288 >gi|15837286|ref|NP_297974.1| hypothetical protein XF0684 [Xylella fastidiosa 9a5c] gi|9105566|gb|AAF83494.1|AE003912_6 phage-related protein [Xylella fastidiosa 9a5c] Length = 503 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 254 ITPFQFESKDVRIQLDEASAPWFNANDVCSILEF 287 >gi|28199601|ref|NP_779915.1| hypothetical protein PD1726 [Xylella fastidiosa Temecula1] gi|77747679|ref|NP_779339.2| hypothetical protein PD1133 [Xylella fastidiosa Temecula1] gi|28057716|gb|AAO29564.1| phage-related protein [Xylella fastidiosa Temecula1] Length = 503 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 254 ITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 287 >gi|182681747|ref|YP_001829907.1| prophage antirepressor [Xylella fastidiosa M23] gi|182682342|ref|YP_001830502.1| prophage antirepressor [Xylella fastidiosa M23] gi|28057123|gb|AAO28988.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631857|gb|ACB92633.1| prophage antirepressor [Xylella fastidiosa M23] gi|182632452|gb|ACB93228.1| prophage antirepressor [Xylella fastidiosa M23] gi|307578623|gb|ADN62592.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] gi|307580176|gb|ADN64145.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 535 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 167 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 205 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 286 ITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 319 >gi|273810427|ref|YP_003344898.1| Bro-N family protein [Xylella phage Xfas53] gi|257097802|gb|ACV41108.1| Bro-N family protein [Xylella phage Xfas53] Length = 431 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 180 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 218 >gi|71898928|ref|ZP_00681095.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71731340|gb|EAO33404.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 387 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 137 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 175 >gi|71276718|ref|ZP_00652986.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71276734|ref|ZP_00653001.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900867|ref|ZP_00682983.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71902520|ref|ZP_00684445.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162461|gb|EAO12196.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71162476|gb|EAO12210.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71727755|gb|EAO30023.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71729338|gb|EAO31453.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 370 Score = 53.5 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L +T+ Sbjct: 1 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 39 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 121 ITPFQFESKDVRIQLDEASAPWFNANDVCAVLEF 154 >gi|71901490|ref|ZP_00683577.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71728746|gb|EAO30890.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 412 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L + + Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYAN 199 >gi|28198899|ref|NP_779213.1| hypothetical protein PD1001 [Xylella fastidiosa Temecula1] gi|182681602|ref|YP_001829762.1| prophage antirepressor [Xylella fastidiosa M23] gi|28056997|gb|AAO28862.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631712|gb|ACB92488.1| prophage antirepressor [Xylella fastidiosa M23] gi|307580036|gb|ADN64005.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 262 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ M PF E + +R VVD+ G WF+ DVA L + + Sbjct: 12 MNAMTPFQFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 50 >gi|15838264|ref|NP_298952.1| hypothetical protein XF1663 [Xylella fastidiosa 9a5c] gi|9106723|gb|AAF84472.1|AE003992_8 phage-related protein [Xylella fastidiosa 9a5c] Length = 381 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L + + Sbjct: 12 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYAN 50 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +RI +DE WF DV L+F Sbjct: 132 ITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 165 >gi|71899745|ref|ZP_00681896.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730440|gb|EAO32520.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 251 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E + +R VVD+ G WF+ DVA L + + Sbjct: 1 MNAITPFHFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 39 >gi|169633393|ref|YP_001707129.1| hypothetical protein ABSDF1750 [Acinetobacter baumannii SDF] gi|169152185|emb|CAP01089.1| hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 260 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFIAADVATVLGY 37 >gi|184157378|ref|YP_001845717.1| prophage antirepressor [Acinetobacter baumannii ACICU] gi|183208972|gb|ACC56370.1| Prophage antirepressor [Acinetobacter baumannii ACICU] Length = 250 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ FN N IR V+ +DG WF+ DVA L+++ Sbjct: 1 MSNISVFNFNQNEIRTVLKDDGEIWFVASDVATVLEYS 38 >gi|169634092|ref|YP_001707828.1| hypothetical protein ABSDF2615 [Acinetobacter baumannii SDF] gi|169152884|emb|CAP01922.1| conserved hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 94 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFVAADVATVLGY 37 >gi|144898901|emb|CAM75765.1| BRO, N-terminal [Magnetospirillum gryphiswaldense MSR-1] Length = 300 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M++++PF E + IR VVD DG WF+ KDVA L + + T Sbjct: 1 MTNIVPFEFEGSAIR-VVDIDGAPWFVGKDVAERLGYANAT 40 >gi|312962012|ref|ZP_07776509.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] gi|311283822|gb|EFQ62406.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] Length = 283 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 25/37 (67%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S +IPF+ + IR++ D+ G+ WF+ +DVA L ++ Sbjct: 28 SAVIPFDFDGAAIRVITDKLGDPWFVARDVADALGYS 64 >gi|330810751|ref|YP_004355213.1| phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327378859|gb|AEA70209.1| Putative phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 283 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + +IPF+ + IR++ DE G+ WF+ +DVA L + Sbjct: 28 NSVIPFDFDGGAIRVITDELGDPWFVARDVADALGY 63 >gi|283852564|ref|ZP_06369831.1| prophage antirepressor [Desulfovibrio sp. FW1012B] gi|283572012|gb|EFC20005.1| prophage antirepressor [Desulfovibrio sp. FW1012B] Length = 323 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 24/37 (64%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S+ +PF E + IR V++ DGN WF+ +DV ++ + Sbjct: 13 SNPVPFAFESHEIRTVINGDGNPWFVARDVCAAMNIS 49 >gi|53803190|ref|YP_115046.1| hypothetical protein MCA2642 [Methylococcus capsulatus str. Bath] gi|53756951|gb|AAU91242.1| conserved domain protein [Methylococcus capsulatus str. Bath] Length = 252 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++IPF+ E P+R+V D G WF+ DVA L++ Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVAQSLEY 38 >gi|310286594|ref|YP_003937852.1| phage anti-repressor protein [Bifidobacterium bifidum S17] gi|309250530|gb|ADO52278.1| putative phage anti-repressor protein [Bifidobacterium bifidum S17] Length = 260 Score = 44.2 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 23/36 (63%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++ PF+ + N +RI+ D+ G WF+ KDV L + Sbjct: 4 NNLQPFDFKGNQVRILTDKKGEPWFVAKDVCNVLGY 39 >gi|307544693|ref|YP_003897172.1| prophage antirepressor [Halomonas elongata DSM 2581] gi|307216717|emb|CBV41987.1| prophage antirepressor [Halomonas elongata DSM 2581] Length = 262 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M + PFN + +R++ +DG F+ KDVA L + Sbjct: 1 MQSIQPFNFDSQQVRVIQGDDGEPMFVAKDVAAALGY 37 >gi|71901481|ref|ZP_00683568.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71728737|gb|EAO30881.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 188 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DVA L + Sbjct: 4 SIIPFDFHSHSVRVVM-RDGNPWFVATDVAVALGY 37 >gi|160898695|ref|YP_001564277.1| prophage antirepressor [Delftia acidovorans SPH-1] gi|160364279|gb|ABX35892.1| prophage antirepressor [Delftia acidovorans SPH-1] Length = 270 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 25/38 (65%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ PF + + I ++ ++ G WF+ K+V+G L ++ Sbjct: 1 MSNITPFKFQDHEITVLTNDSGEPWFIAKEVSGVLGYS 38 >gi|71276717|ref|ZP_00652985.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900866|ref|ZP_00682982.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162475|gb|EAO12209.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71729337|gb|EAO31452.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 264 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAATS 41 >gi|170730310|ref|YP_001775743.1| hypothetical protein Xfasm12_1161 [Xylella fastidiosa M12] gi|167965103|gb|ACA12113.1| conserved hypothetical protein [Xylella fastidiosa M12] Length = 193 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DV L + Sbjct: 4 SIIPFDFHSHAVRVVM-RDGNPWFVATDVCTALGY 37 >gi|9107709|gb|AAF85304.1|AE004058_5 hypothetical protein XF_2506 [Xylella fastidiosa 9a5c] Length = 460 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DV L + Sbjct: 192 SIIPFDFHSHAVRVVM-RDGNPWFVATDVCTALGY 225 >gi|77747607|ref|NP_299784.2| hypothetical protein XF2506 [Xylella fastidiosa 9a5c] Length = 272 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DV L + Sbjct: 4 SIIPFDFHSHAVRVVM-RDGNPWFVATDVCTALGY 37 >gi|71899743|ref|ZP_00681894.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730438|gb|EAO32518.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 203 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAETS 41 >gi|307580159|gb|ADN64128.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 188 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DVA L + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFVATDVAVALGY 37 >gi|273810441|ref|YP_003344912.1| Bro-N family protein [Xylella phage Xfas53] gi|257097816|gb|ACV41122.1| Bro-N family protein [Xylella phage Xfas53] Length = 188 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DVA L + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFVATDVAVALGY 37 >gi|28199008|ref|NP_779322.1| hypothetical protein PD1116 [Xylella fastidiosa Temecula1] gi|182681723|ref|YP_001829883.1| prophage antirepressor [Xylella fastidiosa M23] gi|28057106|gb|AAO28971.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631833|gb|ACB92609.1| prophage antirepressor [Xylella fastidiosa M23] Length = 188 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DVA L + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFVATDVAVALGY 37 >gi|71898940|ref|ZP_00681107.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71731352|gb|EAO33416.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 196 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF+ DVA L + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFIATDVAVALGY 37 >gi|108763205|ref|YP_630118.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] gi|108467085|gb|ABF92270.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] Length = 270 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + F+ E + +R+V D G +WF+ KD+A L++ Sbjct: 1 MNQPVAFDFESHHVRVVTDAHGEHWFVAKDIAESLEY 37 >gi|170720501|ref|YP_001748189.1| prophage antirepressor [Pseudomonas putida W619] gi|169758504|gb|ACA71820.1| prophage antirepressor [Pseudomonas putida W619] Length = 256 Score = 41.9 bits (97), Expect = 0.025, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 ++IPFN + IR+V D WF+ KD+A L ++ Sbjct: 2 NLIPFNFNGHEIRVVKDHANEPWFVAKDIADDLGYS 37 >gi|255020306|ref|ZP_05292374.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] gi|254970226|gb|EET27720.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] Length = 257 Score = 41.9 bits (97), Expect = 0.026, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++IPF+ E P+R+V D G WF+ DV L+ + T Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVCAVLELPNTT 42 >gi|71899744|ref|ZP_00681895.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730439|gb|EAO32519.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 196 Score = 41.9 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF+ + +R+V+ DGN WF DVA L + Sbjct: 4 SIIPFDFHSHVVRVVM-RDGNPWFAATDVAVALGY 37 >gi|239621455|ref|ZP_04664486.1| prophage antirepressor [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239515916|gb|EEQ55783.1| prophage antirepressor [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 255 Score = 41.2 bits (95), Expect = 0.044, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 S++ PF NP+ V E+G F K VA L + Sbjct: 4 SNVQPFEFRGNPVATVTAENGTVLFCAKHVATALGY 39 >gi|224541900|ref|ZP_03682439.1| hypothetical protein CATMIT_01073 [Catenibacterium mitsuokai DSM 15897] gi|224525134|gb|EEF94239.1| hypothetical protein CATMIT_01073 [Catenibacterium mitsuokai DSM 15897] Length = 244 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+++ FN E N +R + + DG WF+ KD A L + Sbjct: 1 MNEVQLFNFESNSVRAL-ERDGQAWFVAKDAAKTLGY 36 >gi|222112392|ref|YP_002554656.1| prophage antirepressor [Acidovorax ebreus TPSY] gi|221731836|gb|ACM34656.1| prophage antirepressor [Acidovorax ebreus TPSY] Length = 252 Score = 41.2 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +R+ VD+ G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRVQVDDQGQPWFNATDVCDALE 36 >gi|296112028|ref|YP_003622410.1| putative antirepressor - phage associated [Leuconostoc kimchii IMSNU 11154] gi|295833560|gb|ADG41441.1| putative antirepressor - phage associated [Leuconostoc kimchii IMSNU 11154] Length = 234 Score = 41.2 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+++ FN E N +R VV + W + KDVA L ++ Sbjct: 1 MNEVAVFNFETNEVRTVVINEE-VWLVAKDVATTLGYS 37 >gi|37527835|ref|NP_931180.1| hypothetical protein plu3980 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36787271|emb|CAE16352.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 190 Score = 41.2 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 + PF E+ +R ++ ++GN+WF+ +DV L T+ Sbjct: 5 SVTPFIFENQQVRTLI-KNGNFWFVAQDVCDALKITN 40 >gi|317163970|gb|ADV07511.1| putative phage associated protein [Neisseria gonorrhoeae TCDC-NG08107] Length = 108 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|260440833|ref|ZP_05794649.1| putative phage associated protein [Neisseria gonorrhoeae DGI2] gi|291044151|ref|ZP_06569867.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|291012614|gb|EFE04603.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240127893|ref|ZP_04740554.1| putative phage associated protein [Neisseria gonorrhoeae SK-93-1035] gi|268686287|ref|ZP_06153149.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035] gi|268626571|gb|EEZ58971.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240123213|ref|ZP_04736169.1| putative phage associated protein [Neisseria gonorrhoeae PID332] gi|268681838|ref|ZP_06148700.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332] gi|268622122|gb|EEZ54522.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240117658|ref|ZP_04731720.1| putative phage associated protein [Neisseria gonorrhoeae PID1] gi|268603359|ref|ZP_06137526.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1] gi|268587490|gb|EEZ52166.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240115355|ref|ZP_04729417.1| putative phage associated protein [Neisseria gonorrhoeae PID18] gi|268601036|ref|ZP_06135203.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] gi|268585167|gb|EEZ49843.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240112608|ref|ZP_04727098.1| putative phage associated protein [Neisseria gonorrhoeae MS11] gi|268598677|ref|ZP_06132844.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] gi|268582808|gb|EEZ47484.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240081025|ref|ZP_04725568.1| putative phage associated protein [Neisseria gonorrhoeae FA19] gi|268597136|ref|ZP_06131303.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|268550924|gb|EEZ45943.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|240014407|ref|ZP_04721320.1| putative phage associated protein [Neisseria gonorrhoeae DGI18] Length = 278 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|239998687|ref|ZP_04718611.1| putative phage associated protein [Neisseria gonorrhoeae 35/02] gi|268594538|ref|ZP_06128705.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] gi|268547927|gb|EEZ43345.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] Length = 281 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|254493410|ref|ZP_05106581.1| predicted protein [Neisseria gonorrhoeae 1291] gi|226512450|gb|EEH61795.1| predicted protein [Neisseria gonorrhoeae 1291] Length = 283 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|194098248|ref|YP_002001304.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945] gi|193933538|gb|ACF29362.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945] Length = 281 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|59801452|ref|YP_208164.1| putative phage associated protein [Neisseria gonorrhoeae FA 1090] gi|240016839|ref|ZP_04723379.1| putative phage associated protein [Neisseria gonorrhoeae FA6140] gi|240120878|ref|ZP_04733840.1| putative phage associated protein [Neisseria gonorrhoeae PID24-1] gi|240125457|ref|ZP_04738343.1| putative phage associated protein [Neisseria gonorrhoeae SK-92-679] gi|268684051|ref|ZP_06150913.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679] gi|59718347|gb|AAW89752.1| hypothetical protein, putative phage associated protein [Neisseria gonorrhoeae FA 1090] gi|268624335|gb|EEZ56735.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679] Length = 281 Score = 41.2 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +T+ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTN 39 >gi|323517747|gb|ADX92128.1| prophage antirepressor [Acinetobacter baumannii TCDC-AB0715] Length = 253 Score = 40.4 bits (93), Expect = 0.083, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 24/41 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M+++ FN +R +V +DG WF++ DV L+ +++ Sbjct: 1 MNNVSVFNFNQKEVRTIVKKDGEIWFVLSDVCNVLEIGNVS 41 >gi|258543092|ref|YP_003188525.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256634170|dbj|BAI00146.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256637230|dbj|BAI03199.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-03] gi|256640282|dbj|BAI06244.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-07] gi|256643339|dbj|BAI09294.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-22] gi|256646394|dbj|BAI12342.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-26] gi|256649447|dbj|BAI15388.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-32] gi|256652433|dbj|BAI18367.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655491|dbj|BAI21418.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-12] Length = 234 Score = 40.4 bits (93), Expect = 0.088, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++IPFN E + +R++ DG WF++ DV L+ T+ Sbjct: 1 MSNIIPFNFEDHAVRVIT-RDGEPWFVLADVCDVLEHTN 38 >gi|15320633|ref|NP_203477.1| hypothetical protein Mx8p63 [Myxococcus phage Mx8] gi|15281743|gb|AAK94398.1|AF396866_63 p63 [Myxococcus phage Mx8] Length = 245 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 6 PFNLE-HNPIRIVVDEDGNYWFMVKDVAGGLDF 37 PF E IR+VVDE G WF+ +D+A L++ Sbjct: 13 PFLFEGSTRIRVVVDEAGEPWFVAQDIAHALEY 45 >gi|148912801|ref|YP_001293380.1| Conserved hypothetical protein; putative antirepressor [Pseudomonas phage F10] Length = 265 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 24/36 (66%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 ++IP++ ++++VDE+G WF+ +VA L ++ Sbjct: 2 NLIPYDFNSKRLQVLVDENGEPWFIAMEVAEILGYS 37 >gi|294102125|ref|YP_003553983.1| prophage antirepressor [Aminobacterium colombiense DSM 12261] gi|293617105|gb|ADE57259.1| prophage antirepressor [Aminobacterium colombiense DSM 12261] Length = 257 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M + F E+ +R+ +DE GN W++ +DV L +++ Sbjct: 1 MKGLQIFEFENQDVRVRIDEAGNPWWVARDVCDVLGYSN 39 >gi|227496445|ref|ZP_03926729.1| phage antirepressor protein [Actinomyces urogenitalis DSM 15434] gi|226834027|gb|EEH66410.1| phage antirepressor protein [Actinomyces urogenitalis DSM 15434] Length = 262 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++IPF+ E R + D G WF+ DV L ++ Sbjct: 1 MSEVIPFDYEGTNFRALQDSAGEPWFVANDVCEALGLSN 39 >gi|254804765|ref|YP_003082986.1| putative prophage antirepressor protein [Neisseria meningitidis alpha14] gi|254668307|emb|CBA05261.1| putative prophage antirepressor protein [Neisseria meningitidis alpha14] Length = 282 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + N +R V D G WF+ DV L +++ Sbjct: 1 MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYSN 39 >gi|294789953|ref|ZP_06755172.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] gi|294482110|gb|EFG29818.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] Length = 283 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 2 SDMIPFNL-EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 + + F E++ IR + DE G +WF+ DV G L + + Sbjct: 14 NQISTFKFSENHSIRTIADEKGEFWFLANDVCGVLGYVN 52 >gi|299530348|ref|ZP_07043773.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] gi|298721719|gb|EFI62651.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 24/38 (63%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ PF + + + ++ D+DG+ F+ +VA L ++ Sbjct: 1 MSNITPFVFDGHNVTVIADDDGSLRFVAMEVADILGYS 38 >gi|190573874|ref|YP_001971719.1| putative phage-like protein [Stenotrophomonas maltophilia K279a] gi|190011796|emb|CAQ45416.1| putative phage-related protein [Stenotrophomonas maltophilia K279a] Length = 253 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +RI VD G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRIQVDGAGLPWFNASDVCNALE 36 >gi|167039880|ref|YP_001662865.1| prophage antirepressor [Thermoanaerobacter sp. X514] gi|300915306|ref|ZP_07132620.1| prophage antirepressor [Thermoanaerobacter sp. X561] gi|307724796|ref|YP_003904547.1| prophage antirepressor [Thermoanaerobacter sp. X513] gi|166854120|gb|ABY92529.1| prophage antirepressor [Thermoanaerobacter sp. X514] gi|300888582|gb|EFK83730.1| prophage antirepressor [Thermoanaerobacter sp. X561] gi|307581857|gb|ADN55256.1| prophage antirepressor [Thermoanaerobacter sp. X513] Length = 263 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M+ + FN E N +R V+ +DGN W+++KDV LD Sbjct: 1 MNKITLFNYEGNTVRTVM-KDGNPWWVLKDVCSVLD 35 >gi|170730325|ref|YP_001775758.1| hypothetical protein Xfasm12_1177 [Xylella fastidiosa M12] gi|167965118|gb|ACA12128.1| conserved hypothetical protein [Xylella fastidiosa M12] Length = 420 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + PF E +RI +DE WF DV L+F Sbjct: 169 MNAITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 205 >gi|71899883|ref|ZP_00682031.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730323|gb|EAO32406.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 388 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + PF E +RI +DE WF DV L+F Sbjct: 137 MNAITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 173 >gi|71901327|ref|ZP_00683423.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71728911|gb|EAO31046.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 388 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + PF E +RI +DE WF DV L+F Sbjct: 137 MNAITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 173 >gi|71276266|ref|ZP_00652544.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900321|ref|ZP_00682456.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162874|gb|EAO12598.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71729896|gb|EAO31992.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 408 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + PF E +RI +DE WF DV L+F Sbjct: 157 MNAITPFQFESKDVRIQLDEANAPWFNANDVCAVLEF 193 >gi|301170189|emb|CBW29793.1| conserved hypothetical protein [Haemophilus influenzae 10810] Length = 225 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 F + N +R++ D++ WF DV L +++ Sbjct: 10 FTFKSNSVRVITDKNQEPWFCANDVCDILGYSN 42 >gi|320352352|ref|YP_004193691.1| prophage antirepressor [Desulfobulbus propionicus DSM 2032] gi|320120854|gb|ADW16400.1| prophage antirepressor [Desulfobulbus propionicus DSM 2032] Length = 263 Score = 38.5 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +IPF E N IR + DG+ WF+ +DV L++ Sbjct: 11 VIPFQFESNEIRALT-IDGDPWFVARDVCDVLEY 43 >gi|213967380|ref|ZP_03395528.1| phage protein [Pseudomonas syringae pv. tomato T1] gi|213927681|gb|EEB61228.1| phage protein [Pseudomonas syringae pv. tomato T1] Length = 285 Score = 38.5 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 +S++IPF E +R ++ D WF+ DV+ L ++ Sbjct: 8 VSNVIPFRFETKEVRTLLINDQP-WFVANDVSAALLYS 44 >gi|313123987|ref|YP_004034246.1| anti-repressor-like protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312280550|gb|ADQ61269.1| anti-repressor-like protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] Length = 259 Score = 38.5 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN E +P+R V++ D WF+ KDVA L +++ Sbjct: 8 FNFESSPVR-VIEIDNEPWFVGKDVAKVLGYSN 39 >gi|116492795|ref|YP_804530.1| phage-encoded protein [Pediococcus pentosaceus ATCC 25745] gi|116102945|gb|ABJ68088.1| Uncharacterized phage-encoded protein [Pediococcus pentosaceus ATCC 25745] Length = 267 Score = 38.5 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+++ FN E N +R V+ D Y F+ KDVA + + Sbjct: 1 MNELQNFNFEGNEVRTVLINDEPY-FVGKDVATAIGY 36 >gi|330985509|gb|EGH83612.1| prophage antirepressor [Pseudomonas syringae pv. lachrymans str. M301315] Length = 285 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 +S++IPF E +R ++ D WF+ DV+ L ++ Sbjct: 8 VSNVIPFRFEAKEVRTLLINDQP-WFVANDVSAALLYS 44 >gi|262046894|ref|ZP_06019854.1| prophage antirepressor [Lactobacillus crispatus MV-3A-US] gi|260572876|gb|EEX29436.1| prophage antirepressor [Lactobacillus crispatus MV-3A-US] Length = 267 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+ + FN E++ +R VV DG WF+ KDVA L ++ Sbjct: 1 MNQLTLFNFENSQLR-VVKIDGEPWFVGKDVAQILGYS 37 >gi|260555806|ref|ZP_05828026.1| gp54 protein [Acinetobacter baumannii ATCC 19606] gi|260410717|gb|EEX04015.1| gp54 protein [Acinetobacter baumannii ATCC 19606] Length = 184 Score = 38.5 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+ + F+ + +RIV+D++ WF + DV LD + Sbjct: 1 MNAITHFDFKSRSVRIVLDDNQEPWFCLTDVCKALDIS 38 >gi|269955332|ref|YP_003325121.1| prophage antirepressor [Xylanimonas cellulosilytica DSM 15894] gi|269304013|gb|ACZ29563.1| prophage antirepressor [Xylanimonas cellulosilytica DSM 15894] Length = 259 Score = 38.5 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSI 40 +D+ F+ +RI+ DE G+ WF+ DVA L +I Sbjct: 3 TDLQQFDFHGAGVRIITDEHGDPWFVAADVAAALSLGNI 41 >gi|209552444|ref|YP_002284359.1| hypothetical protein PAJU2_gp25 [Pseudomonas phage PAJU2] gi|209528717|dbj|BAG75009.1| hypothetical protein [Pseudomonas phage PAJU2] Length = 286 Score = 38.1 bits (87), Expect = 0.37, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 + +IPF + +R ++ +D WF+ DVA L + + Sbjct: 4 AKVIPFQFDAREVRTMLIDDQP-WFVATDVAASLGYPA 40 >gi|218665269|ref|YP_002425545.1| BRO family protein [Acidithiobacillus ferrooxidans ATCC 23270] gi|218517482|gb|ACK78068.1| BRO family protein [Acidithiobacillus ferrooxidans ATCC 23270] Length = 313 Score = 38.1 bits (87), Expect = 0.38, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M ++IPF E IR++ E+G W++ DV L Sbjct: 1 MQNVIPFEYEGRDIRVIPGENGEPWWVAVDVCRALG 36 >gi|169796904|ref|YP_001714697.1| hypothetical protein ABAYE2900 [Acinetobacter baumannii AYE] gi|213156693|ref|YP_002318354.1| gp54 protein [Acinetobacter baumannii AB0057] gi|301346240|ref|ZP_07226981.1| gp54 protein [Acinetobacter baumannii AB056] gi|301513005|ref|ZP_07238242.1| gp54 protein [Acinetobacter baumannii AB058] gi|301597472|ref|ZP_07242480.1| gp54 protein [Acinetobacter baumannii AB059] gi|332874188|ref|ZP_08442111.1| BRO family protein [Acinetobacter baumannii 6014059] gi|169149831|emb|CAM87722.1| hypothetical protein from bacteriophage [Acinetobacter baumannii AYE] gi|213055853|gb|ACJ40755.1| gp54 protein [Acinetobacter baumannii AB0057] gi|323517038|gb|ADX91419.1| hypothetical protein ABTW07_0983 [Acinetobacter baumannii TCDC-AB0715] gi|332737610|gb|EGJ68514.1| BRO family protein [Acinetobacter baumannii 6014059] Length = 184 Score = 37.7 bits (86), Expect = 0.49, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+ + F+ + +RIV+D++ WF + DV LD + Sbjct: 1 MNAVTHFDFKSRSVRIVLDDNQEPWFCLTDVCKALDIS 38 >gi|312114251|ref|YP_004011847.1| prophage antirepressor [Rhodomicrobium vannielii ATCC 17100] gi|311219380|gb|ADP70748.1| prophage antirepressor [Rhodomicrobium vannielii ATCC 17100] Length = 256 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSI 40 + ++PF+ E N +R +V+ DG WF++ DV L+ ++ Sbjct: 5 AAIVPFDFEGNNVR-IVNRDGEAWFVLADVCRVLEIANV 42 >gi|218290598|ref|ZP_03494700.1| prophage antirepressor [Alicyclobacillus acidocaldarius LAA1] gi|218239382|gb|EED06579.1| prophage antirepressor [Alicyclobacillus acidocaldarius LAA1] Length = 256 Score = 37.7 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M ++PF E +R+VV DG W++ KDV L Sbjct: 4 MDTLLPFEYEGKQVRVVV-VDGEPWWVAKDVCDVLG 38 >gi|292491104|ref|YP_003526543.1| BRO domain protein [Nitrosococcus halophilus Nc4] gi|291579699|gb|ADE14156.1| BRO domain protein [Nitrosococcus halophilus Nc4] Length = 316 Score = 37.7 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M+D+IPFN + + IR+V+ DG WF+ KD+ L+ Sbjct: 1 MNDLIPFNFDGHDIRVVM-IDGEPWFVAKDLCDVLE 35 >gi|309378131|emb|CBX23230.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 282 Score = 37.7 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + N + + +R V D G WF+ DV L +++ Sbjct: 1 MNAVQVLNFQQSSVRTVADNKGELWFLANDVCEILGYSN 39 >gi|295086054|emb|CBK67577.1| Prophage antirepressor [Bacteroides xylanisolvens XB1A] Length = 258 Score = 37.7 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 10 EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 E IR V++DG WF KDVA L + + Sbjct: 11 EFGKIRT-VEKDGKIWFCAKDVAASLGYAN 39 >gi|265755711|ref|ZP_06090332.1| BRO family antirepressor [Bacteroides sp. 3_1_33FAA] gi|263234317|gb|EEZ19910.1| BRO family antirepressor [Bacteroides sp. 3_1_33FAA] Length = 258 Score = 37.7 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 10 EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 E IR V++DG WF KDVA L + + Sbjct: 11 EFGKIRT-VEKDGKIWFCAKDVAASLGYAN 39 >gi|332852416|ref|ZP_08434185.1| hypothetical protein HMPREF0021_01760 [Acinetobacter baumannii 6013150] gi|332870997|ref|ZP_08439610.1| hypothetical protein HMPREF0020_03263 [Acinetobacter baumannii 6013113] gi|332729260|gb|EGJ60602.1| hypothetical protein HMPREF0021_01760 [Acinetobacter baumannii 6013150] gi|332731757|gb|EGJ63037.1| hypothetical protein HMPREF0020_03263 [Acinetobacter baumannii 6013113] Length = 51 Score = 37.3 bits (85), Expect = 0.64, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+ + F+ + +RIV+D++ WF + DV LD + Sbjct: 1 MNAITHFDFKSRSVRIVLDDNQEPWFCLTDVCKALDIS 38 >gi|257879465|ref|ZP_05659118.1| BRO [Enterococcus faecium 1,230,933] gi|257881736|ref|ZP_05661389.1| BRO [Enterococcus faecium 1,231,502] gi|257890224|ref|ZP_05669877.1| BRO [Enterococcus faecium 1,231,410] gi|260558840|ref|ZP_05831029.1| anti-repressor protein [Enterococcus faecium C68] gi|293560440|ref|ZP_06676932.1| phage anti-repressor protein [Enterococcus faecium E1162] gi|293570339|ref|ZP_06681398.1| phage anti-repressor protein [Enterococcus faecium E980] gi|294621638|ref|ZP_06700803.1| phage anti-repressor protein [Enterococcus faecium U0317] gi|257813693|gb|EEV42451.1| BRO [Enterococcus faecium 1,230,933] gi|257817394|gb|EEV44722.1| BRO [Enterococcus faecium 1,231,502] gi|257826584|gb|EEV53210.1| BRO [Enterococcus faecium 1,231,410] gi|260075299|gb|EEW63612.1| anti-repressor protein [Enterococcus faecium C68] gi|291598803|gb|EFF29855.1| phage anti-repressor protein [Enterococcus faecium U0317] gi|291605588|gb|EFF35030.1| phage anti-repressor protein [Enterococcus faecium E1162] gi|291609585|gb|EFF38848.1| phage anti-repressor protein [Enterococcus faecium E980] Length = 258 Score = 37.3 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ FN E N +R ++ D Y F+ KDVA L +++ Sbjct: 1 MNTPQIFNFEQNEVRTILVNDEPY-FVGKDVASVLGYSN 38 >gi|314950087|ref|ZP_07853373.1| toxin-antitoxin system, toxin component, Bro family [Enterococcus faecium TX0082] gi|313643528|gb|EFS08108.1| toxin-antitoxin system, toxin component, Bro family [Enterococcus faecium TX0082] Length = 261 Score = 37.3 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ FN E N +R ++ D Y F+ KDVA L +++ Sbjct: 4 MNTPQIFNFEQNEVRTILVNDEPY-FVGKDVASVLGYSN 41 >gi|294341350|emb|CAZ89766.1| putative Prophage antirepressor [Thiomonas sp. 3As] Length = 413 Score = 37.3 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSI 40 +I + E NPI + + EDG+ W+ K + L F + Sbjct: 10 IIRLDFEGNPILVQMGEDGSVWYTAKPLCTALGFKKM 46 >gi|192291449|ref|YP_001992054.1| prophage antirepressor [Rhodopseudomonas palustris TIE-1] gi|192285198|gb|ACF01579.1| prophage antirepressor [Rhodopseudomonas palustris TIE-1] Length = 270 Score = 37.3 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + PF E +R +V++ G WF+ DVA L + Sbjct: 5 TVSPFQFEGRNVR-LVEQGGETWFVATDVARELGY 38 >gi|220920614|ref|YP_002495915.1| prophage antirepressor [Methylobacterium nodulans ORS 2060] gi|219945220|gb|ACL55612.1| prophage antirepressor [Methylobacterium nodulans ORS 2060] Length = 295 Score = 36.9 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + F+ E +R + DG WF+ DV L T+ Sbjct: 1 MNALQTFDFESQAVRSF-ERDGQVWFVAADVCRALGLTN 38 >gi|30995448|ref|NP_439568.2| hypothetical protein HI1418 [Haemophilus influenzae Rd KW20] Length = 188 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + P+R+++D G +WF DV L +T+ Sbjct: 10 FNFKDLPVRVILDPKGEFWFCGTDVCHILGYTN 42 >gi|1175791|sp|P44189|Y1418_HAEIN RecName: Full=Uncharacterized protein HI_1418 gi|1574254|gb|AAC23068.1| predicted coding region HI1418 [Haemophilus influenzae Rd KW20] Length = 201 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + P+R+++D G +WF DV L +T+ Sbjct: 23 FNFKDLPVRVILDPKGEFWFCGTDVCHILGYTN 55 >gi|76809803|ref|YP_333048.1| BRO domain-containing protein [Burkholderia pseudomallei 1710b] gi|76579256|gb|ABA48731.1| BRO family, N-terminal domain protein [Burkholderia pseudomallei 1710b] Length = 239 Score = 36.9 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MSD+ F E +R V +G+ WF+ KDV L T+ Sbjct: 1 MSDLTLFKFEGRNLRT-VKINGDPWFVAKDVCDVLGITN 38 >gi|224475960|ref|YP_002633566.1| putative antirepressor, phage associated [Staphylococcus carnosus subsp. carnosus TM300] gi|222420567|emb|CAL27381.1| putative antirepressor, phage associated [Staphylococcus carnosus subsp. carnosus TM300] Length = 255 Score = 36.9 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E P+R ++ +D Y F+ KDVA L +++ Sbjct: 1 MSELQVFNFEELPVRTLIMDDEPY-FVGKDVAEVLGYSN 38 >gi|308180883|ref|YP_003925011.1| hypothetical protein LPST_C1701 [Lactobacillus plantarum subsp. plantarum ST-III] gi|308046374|gb|ADN98917.1| hypothetical protein LPST_C1701 [Lactobacillus plantarum subsp. plantarum ST-III] Length = 250 Score = 36.9 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PFN E + +R + + + WF + D++ L ++ Sbjct: 1 MNQITPFNFEGHQVRTI-ERENIIWFAMPDISKSLGLSN 38 >gi|330977751|gb|EGH77654.1| hypothetical protein PSYAP_13385 [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 140 Score = 36.9 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 + + PF+ PIR++ G +F+ KD+A L + + + Sbjct: 28 AQVTPFDFHGFPIRVLDSIHGEPYFIAKDIAEALGYANTS 67 >gi|307826181|ref|ZP_07656392.1| prophage antirepressor [Methylobacter tundripaludum SV96] gi|307732820|gb|EFO03686.1| prophage antirepressor [Methylobacter tundripaludum SV96] Length = 193 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 13/31 (41%) Query: 6 PFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 PF IR DE WF KDV LD Sbjct: 10 PFQFSELDIRTATDEHSEVWFNAKDVCTALD 40 >gi|37526842|ref|NP_930186.1| hypothetical protein plu2952 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36786274|emb|CAE15326.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 271 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 S+ F + IR V+++DG WF+ DV L+ +IT Sbjct: 11 SNFTIFKFGSHEIR-VINKDGEPWFVAHDVCSALEIQNIT 49 >gi|260580749|ref|ZP_05848575.1| conserved hypothetical protein [Haemophilus influenzae RdAW] gi|260092566|gb|EEW76503.1| conserved hypothetical protein [Haemophilus influenzae RdAW] Length = 222 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + P+R+++D G +WF DV L +T+ Sbjct: 10 FNFKDLPVRVILDPKGEFWFCGTDVCHILGYTN 42 >gi|169632805|ref|YP_001706541.1| putative prophage antirepressor [Acinetobacter baumannii SDF] gi|169151597|emb|CAP00374.1| conserved hypothetical protein; putative prophage antirepressor [Acinetobacter baumannii] Length = 268 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E N ++ + N WF+ KD+ L ++ Sbjct: 1 MSNLSVFNFEQNSQIRIIMINSNPWFVAKDICDALGLSN 39 >gi|188581117|ref|YP_001924562.1| prophage antirepressor [Methylobacterium populi BJ001] gi|179344615|gb|ACB80027.1| prophage antirepressor [Methylobacterium populi BJ001] Length = 293 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + + PF+ E P+R VV DG F+ D+A L + Sbjct: 19 ASITPFDFEGTPVR-VVSVDGEPCFVASDLARSLGY 53 >gi|68250068|ref|YP_249180.1| hypothetical protein NTHI1733 [Haemophilus influenzae 86-028NP] gi|68058267|gb|AAX88520.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP] Length = 261 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN +++P+R + D + WF DV L + + Sbjct: 49 FNFKNSPVRTITDPNSEIWFCGTDVCDILGYVN 81 >gi|319896720|ref|YP_004134913.1| hypothetical protein HIBPF03470 [Haemophilus influenzae F3031] gi|317432222|emb|CBY80574.1| conserved hypothetical protein [Haemophilus influenzae F3031] Length = 240 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + P+R++ D G +WF DV L +T+ Sbjct: 52 FNFKDLPVRVISDPKGEFWFCGTDVCAILGYTN 84 >gi|319775742|ref|YP_004138230.1| hypothetical protein HICON_10850 [Haemophilus influenzae F3047] gi|317450333|emb|CBY86549.1| conserved hypothetical protein [Haemophilus influenzae F3047] Length = 240 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + P+R++ D G +WF DV L +T+ Sbjct: 52 FNFKDLPVRVISDPKGEFWFCGTDVCAILGYTN 84 >gi|227431802|ref|ZP_03913829.1| prophage LambdaSa2, antirepressor protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227352485|gb|EEJ42684.1| prophage LambdaSa2, antirepressor protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 237 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN E + +R + ED WF+ KDVA L +++ Sbjct: 8 FNFETSRVRTLNLEDV-IWFVGKDVADTLGYSA 39 >gi|160946092|ref|ZP_02093306.1| hypothetical protein PEPMIC_00041 [Parvimonas micra ATCC 33270] gi|158447824|gb|EDP24819.1| hypothetical protein PEPMIC_00041 [Parvimonas micra ATCC 33270] Length = 255 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M+ + F + N +R ++ +DG WF+ KDV L+ T+ T Sbjct: 1 MNQLKVFGFKQNEVRTIL-KDGEPWFVAKDVCEILEITNPT 40 >gi|319775359|ref|YP_004137847.1| prophage antirepressor [Haemophilus influenzae F3047] gi|329122641|ref|ZP_08251220.1| phage antirepressor protein [Haemophilus aegyptius ATCC 11116] gi|317449950|emb|CBY86162.1| Possible prophage antirepressor [Haemophilus influenzae F3047] gi|327472655|gb|EGF18084.1| phage antirepressor protein [Haemophilus aegyptius ATCC 11116] Length = 214 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN ++ P+R + D + WF DV L +++ Sbjct: 10 FNFKNFPVRTITDPNSEIWFCGTDVCDILGYSN 42 >gi|308048839|ref|YP_003912405.1| prophage antirepressor [Ferrimonas balearica DSM 9799] gi|307631029|gb|ADN75331.1| prophage antirepressor [Ferrimonas balearica DSM 9799] Length = 260 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 7 FNLEHNPIRIVVD-EDGNYWFMVKDVAGGLDF 37 FN IR++ D +DG +F+ KDVA L F Sbjct: 120 FNFNTASIRVIPDFKDGQPYFVAKDVAEALGF 151 >gi|46205473|ref|ZP_00048502.2| COG3617: Prophage antirepressor [Magnetospirillum magnetotacticum MS-1] Length = 163 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + + PF+ E P+R VV DG F+ D+A L + Sbjct: 19 ASITPFDFEGTPVR-VVSVDGEPCFVAADLARSLGY 53 >gi|220903506|ref|YP_002478818.1| prophage antirepressor [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219867805|gb|ACL48140.1| prophage antirepressor [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 180 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF--TSIT 41 F ++ +R+ DE G WF+ KDVA L++ +SIT Sbjct: 8 FVFGNSDVRVAQDETGVLWFVAKDVAEALEYQESSIT 44 >gi|270635191|ref|ZP_06222052.1| conserved hypothetical protein [Haemophilus influenzae HK1212] gi|270317460|gb|EFA28953.1| conserved hypothetical protein [Haemophilus influenzae HK1212] Length = 163 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 FN + + +R++ D + +WF DV L + Sbjct: 10 FNFKSSQVRVITDPNQEFWFCGSDVCYILGY 40 >gi|270659695|ref|ZP_06222358.1| conserved hypothetical protein [Haemophilus influenzae HK1212] gi|270316963|gb|EFA28644.1| conserved hypothetical protein [Haemophilus influenzae HK1212] Length = 77 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 FN + + +R++ D + +WF DV L + Sbjct: 10 FNFKSSQVRVITDPNQEFWFCGSDVCYILGY 40 >gi|332560969|ref|ZP_08415287.1| BRO domain protein [Rhodobacter sphaeroides WS8N] gi|332274767|gb|EGJ20083.1| BRO domain protein [Rhodobacter sphaeroides WS8N] Length = 197 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++IPF+ E PIR ++ DG+ W++ DV L+ + T Sbjct: 3 AELIPFDFEDQPIRTLL-RDGSPWWVAADVCRVLEIQNPT 41 >gi|317487261|ref|ZP_07946056.1| BRO family domain-containing protein [Bilophila wadsworthia 3_1_6] gi|316921451|gb|EFV42742.1| BRO family domain-containing protein [Bilophila wadsworthia 3_1_6] Length = 325 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 F + +R V E GN WF+ KDVA L FT Sbjct: 81 FPVTRQKVRTVWHE-GNVWFVAKDVAECLGFT 111 >gi|14251162|ref|NP_116530.1| hypothetical protein BK5-Tp38 [Lactococcus phage BK5-T] gi|928839|gb|AAA98590.1| unknown [Lactococcus phage BK5-T] gi|26005559|emb|CAC80179.1| hypothetical protein [Lactococcus phage BK5-T] Length = 266 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+++ FN + P+R V+ D WF+ KDVA + + Sbjct: 1 MNELQNFNFNNLPVRTVLINDEP-WFVGKDVAIAIGY 36 >gi|270598466|ref|ZP_06221528.1| conserved hypothetical protein [Haemophilus influenzae HK1212] gi|270318313|gb|EFA29482.1| conserved hypothetical protein [Haemophilus influenzae HK1212] Length = 194 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 S + FN E N IR +V + WF+ KDV L ++++ Sbjct: 5 SQLSTFNFESNSIRTLVINNEP-WFVAKDVCDTLKISNVS 43 >gi|257885097|ref|ZP_05664750.1| BRO [Enterococcus faecium 1,231,501] gi|257820949|gb|EEV48083.1| BRO [Enterococcus faecium 1,231,501] Length = 258 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ F+ E N +R ++ D Y F+ KDVA L +++ Sbjct: 1 MNTPQIFSFEQNEVRTILVNDEPY-FVGKDVASVLGYSN 38 >gi|325849035|ref|ZP_08170527.1| phage antirepressor protein [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|325480280|gb|EGC83343.1| phage antirepressor protein [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 260 Score = 35.8 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%) Query: 8 NLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 N E IRI++DE+ WF+ KDVA L++ Sbjct: 9 NHEFGKIRIILDENNEPWFVGKDVAEILEY 38 >gi|50955842|ref|YP_063130.1| prophage antirepressor protein [Leifsonia xyli subsp. xyli str. CTCB07] gi|50952324|gb|AAT90025.1| prophage antirepressor protein [Leifsonia xyli subsp. xyli str. CTCB07] Length = 260 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++IPF E +R V+ DG WF+++DV L ++ T Sbjct: 4 TEIIPFTFEEVNVRTVL-VDGEPWFILRDVLSVLGLSNPT 42 >gi|289566846|ref|ZP_06447256.1| prophage antirepressor [Enterococcus faecium D344SRF] gi|294616694|ref|ZP_06696464.1| phage anti-repressor protein [Enterococcus faecium E1636] gi|289161377|gb|EFD09267.1| prophage antirepressor [Enterococcus faecium D344SRF] gi|291590448|gb|EFF22187.1| phage anti-repressor protein [Enterococcus faecium E1636] Length = 248 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ FN E N +R ++ D Y F+ KDVA L +++ Sbjct: 1 MNTPQIFNFEQNEVRTILVNDEPY-FVGKDVADVLGYSN 38 >gi|261208361|ref|ZP_05923011.1| anti-repressor protein [Enterococcus faecium TC 6] gi|260077422|gb|EEW65141.1| anti-repressor protein [Enterococcus faecium TC 6] Length = 251 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ FN E N +R ++ D Y F+ KDVA L +++ Sbjct: 4 MNTPQIFNFEQNEVRTILVNDEPY-FVGKDVADVLGYSN 41 >gi|158425230|ref|YP_001526522.1| putative prophage antirepressor [Azorhizobium caulinodans ORS 571] gi|158332119|dbj|BAF89604.1| putative prophage antirepressor [Azorhizobium caulinodans ORS 571] Length = 246 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M+ + PFN + IR+V+ DG WF+ DV L+ Sbjct: 1 MNALTPFNYRDHTIRVVI-LDGEPWFVAADVCRALE 35 >gi|48697283|ref|YP_025050.1| putative antirepressor protein [Lactobacillus phage phiAT3] gi|47607174|gb|AAT36510.1| putative antirepressor protein [Lactobacillus phage phiAT3] Length = 254 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M+++ F E N IR V +G WF DV L T+ T Sbjct: 1 MNELQLFQFEDNQIRT-VSSNGIIWFSAPDVTNALKLTNTT 40 >gi|227535711|ref|ZP_03965760.1| antirepressor protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|227186678|gb|EEI66745.1| antirepressor protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] Length = 254 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M+++ F E N IR V +G WF DV L T+ T Sbjct: 1 MNELQLFQFEDNQIRT-VSSNGIIWFSAPDVTNALKLTNTT 40 >gi|320352343|ref|YP_004193682.1| prophage antirepressor [Desulfobulbus propionicus DSM 2032] gi|320120845|gb|ADW16391.1| prophage antirepressor [Desulfobulbus propionicus DSM 2032] Length = 252 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M ++ PF + +R + D WF+ KDVA L + + Sbjct: 1 MPEITPFCFNDSMVRTLT-IDNAPWFVAKDVAELLGYAN 38 >gi|145636030|ref|ZP_01791706.1| putative antirepressor protein [Haemophilus influenzae PittAA] gi|145266718|gb|EDK06746.1| putative antirepressor protein [Haemophilus influenzae PittAA] Length = 149 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 + + FN E N IR + + WF+ KDV + T+ Sbjct: 5 AQLSTFNFESNSIRTLAINNEP-WFVAKDVCDAIGLTN 41 >gi|226940701|ref|YP_002795775.1| Phage associated-antirepressor [Laribacter hongkongensis HLHK9] gi|226715628|gb|ACO74766.1| Phage associated-antirepressor [Laribacter hongkongensis HLHK9] Length = 214 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 F+ E + +R + DG WF++ DV L F+ Sbjct: 17 FSFESHSVRTIY-RDGEIWFVLNDVTEALAFS 47 >gi|125624905|ref|YP_001033388.1| putative phage antirepressor protein [Lactococcus lactis subsp. cremoris MG1363] gi|124493713|emb|CAL98701.1| putative phage antirepressor protein [Lactococcus lactis subsp. cremoris MG1363] gi|300071704|gb|ADJ61104.1| putative phage antirepressor protein [Lactococcus lactis subsp. cremoris NZ9000] Length = 252 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+++ FN + P+R V+ D WF+ KDVA + + Sbjct: 1 MNELQNFNFNNLPVRTVLINDEP-WFVGKDVAIAIGY 36 >gi|326571054|gb|EGE21078.1| BRO family protein [Moraxella catarrhalis BC7] Length = 279 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNP-IRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ FN E +R + G+ WF + DVA L+ + Sbjct: 1 MSNISIFNFESTKQVRTAIRNGGDIWFCLPDVANVLEIS 39 >gi|167034436|ref|YP_001669667.1| prophage antirepressor [Pseudomonas putida GB-1] gi|166860924|gb|ABY99331.1| prophage antirepressor [Pseudomonas putida GB-1] Length = 285 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 + FN E +R+V+ DG WF +DVA GL +++ Sbjct: 25 TVNLFNFEGFDVRVVL-VDGEPWFSARDVAEGLGYSN 60 >gi|23455724|ref|NP_695033.1| antirepressor [Lactococcus phage r1t] gi|1353522|gb|AAB18680.1| ORF5 [Lactococcus phage r1t] Length = 265 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M ++ FN + P+R V+ D WF+ KDVA + + Sbjct: 1 MKELQNFNFNNLPVRTVLINDEP-WFVGKDVAIAIGY 36 >gi|116512815|ref|YP_811722.1| phage-encoded protein [Lactococcus lactis subsp. cremoris SK11] gi|116108469|gb|ABJ73609.1| Uncharacterized phage-encoded protein [Lactococcus lactis subsp. cremoris SK11] Length = 260 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+++ FN + P+R V+ +D WF+ KDVA L + + Sbjct: 1 MNELQNFNFNNLPVRTVLIDDEP-WFVGKDVAKILGYAN 38 >gi|213692398|ref|YP_002322984.1| hypothetical protein Blon_1525 [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213523859|gb|ACJ52606.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320458539|dbj|BAJ69160.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 111 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 + + PF+ +R++ DE GN WF+ DV L Sbjct: 3 NQIQPFDFNGIQVRVLTDEHGNPWFLGADVCAILG 37 >gi|224282988|ref|ZP_03646310.1| phage antirepressor protein [Bifidobacterium bifidum NCIMB 41171] gi|313140143|ref|ZP_07802336.1| phage antirepressor protein [Bifidobacterium bifidum NCIMB 41171] gi|313132653|gb|EFR50270.1| phage antirepressor protein [Bifidobacterium bifidum NCIMB 41171] Length = 260 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 22/40 (55%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++ F+ +R + D+ G WF+ KDV L ++++ Sbjct: 3 NEIQRFDFRGALLRTLTDKAGEPWFVAKDVCDILGHSNVS 42 >gi|281358555|ref|ZP_06245034.1| prophage antirepressor [Victivallis vadensis ATCC BAA-548] gi|281314903|gb|EFA98937.1| prophage antirepressor [Victivallis vadensis ATCC BAA-548] Length = 304 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 3 DMIPFNLE-HNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 ++ FN E PIR++ DG WF+ KDV L +T+ Sbjct: 5 ELSVFNFEESTPIRVIT-IDGEQWFVGKDVCQVLGYTN 41 >gi|157325452|ref|YP_001468876.1| gp36 [Listeria phage A006] gi|66733457|gb|AAY53271.1| gp36 [Listeria phage A006] Length = 257 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E N +R V E+ + F+ KDVA L +++ Sbjct: 1 MSNLQIFNFEGNEVRTVFIENEPH-FIGKDVAKVLGYSN 38 >gi|281357128|ref|ZP_06243617.1| prophage antirepressor [Victivallis vadensis ATCC BAA-548] gi|281316159|gb|EFB00184.1| prophage antirepressor [Victivallis vadensis ATCC BAA-548] Length = 357 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 3 DMIPFNLE-HNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 ++ FN E PIR++ DG WF+ KDV L +T+ Sbjct: 5 ELSVFNFEESTPIRVIT-IDGEQWFVGKDVCQVLGYTN 41 >gi|210632120|ref|ZP_03297220.1| hypothetical protein COLSTE_01114 [Collinsella stercoris DSM 13279] gi|210159716|gb|EEA90687.1| hypothetical protein COLSTE_01114 [Collinsella stercoris DSM 13279] Length = 251 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 SD+IPF E ++EDG F KDVA L + Sbjct: 4 SDIIPFTSEQFGTVRTIEEDGRVIFCGKDVAAALGY 39 >gi|332686908|ref|YP_004456682.1| phage antirepressor protein [Melissococcus plutonius ATCC 35311] gi|332370917|dbj|BAK21873.1| phage antirepressor protein [Melissococcus plutonius ATCC 35311] Length = 252 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+++ FN E N +R ++ D Y F+ KDVA L + Sbjct: 1 MNELQIFNFEQNEVRTILVNDEPY-FIGKDVAKILGY 36 >gi|260880940|ref|ZP_05403197.2| BRO family domain protein [Mitsuokella multacida DSM 20544] gi|260849978|gb|EEX69985.1| BRO family domain protein [Mitsuokella multacida DSM 20544] Length = 312 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 18/28 (64%) Query: 10 EHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 E +R++ D +GN WF+ KDVA L + Sbjct: 101 EFQQLRVIEDANGNPWFVGKDVAEDLGY 128 >gi|16799158|ref|NP_469426.1| hypothetical protein lin0080 [Listeria innocua Clip11262] gi|224503549|ref|ZP_03671856.1| hypothetical protein LmonFR_13752 [Listeria monocytogenes FSL R2-561] gi|16412500|emb|CAC95313.1| lin0080 [Listeria innocua Clip11262] gi|313633540|gb|EFS00348.1| toxin-antitoxin system, toxin component, Bro family [Listeria seeligeri FSL N1-067] Length = 257 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E N +R V E+ + F+ KDVA L +++ Sbjct: 1 MSNLQIFNFEGNEVRTVFIENEPH-FIGKDVAKVLGYSN 38 >gi|257866260|ref|ZP_05645913.1| prophage antirepressor [Enterococcus casseliflavus EC30] gi|257873224|ref|ZP_05652877.1| prophage antirepressor [Enterococcus casseliflavus EC10] gi|257800218|gb|EEV29246.1| prophage antirepressor [Enterococcus casseliflavus EC30] gi|257807388|gb|EEV36210.1| prophage antirepressor [Enterococcus casseliflavus EC10] Length = 257 Score = 35.0 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + FN E+N +R V+ +D Y F+ KD+A L + Sbjct: 6 MNQLEIFNFENNEVRTVLVDDEPY-FVGKDIAEVLGY 41 >gi|145629495|ref|ZP_01785293.1| hypothetical protein CGSHi22121_08748 [Haemophilus influenzae 22.1-21] gi|145638991|ref|ZP_01794599.1| hypothetical protein CGSHiII_02355 [Haemophilus influenzae PittII] gi|144978338|gb|EDJ88102.1| hypothetical protein CGSHi22121_08748 [Haemophilus influenzae 22.1-21] gi|145271963|gb|EDK11872.1| hypothetical protein CGSHiII_02355 [Haemophilus influenzae PittII] gi|309750953|gb|ADO80937.1| Putative prophage antirepressor protein [Haemophilus influenzae R2866] Length = 213 Score = 35.0 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN +++P+ + D + WF DV L + + Sbjct: 10 FNFKNSPVHTITDPNSEIWFCGTDVCDILGYVN 42 >gi|298384274|ref|ZP_06993834.1| toxin-antitoxin system, toxin component, Bro family [Bacteroides sp. 1_1_14] gi|298262553|gb|EFI05417.1| toxin-antitoxin system, toxin component, Bro family [Bacteroides sp. 1_1_14] Length = 256 Score = 34.6 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Query: 1 MSDMIPFNL-EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + F E IR + D DG WF DVA L + + Sbjct: 1 MNKISIFEHPEFGRIRTL-DIDGKIWFCASDVASALGYAN 39 >gi|319411146|emb|CBY91551.1| Uncharacterized protein HI1418 [Neisseria meningitidis WUE 2594] Length = 280 Score = 34.6 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + FN N I+ V++++G WF+ +VA L + Sbjct: 1 MNQVQYFNFNQNAIQ-VINKNGEAWFIASEVAAMLGY 36 >gi|296113177|ref|YP_003627115.1| BRO family protein [Moraxella catarrhalis RH4] gi|295920871|gb|ADG61222.1| BRO family protein [Moraxella catarrhalis RH4] Length = 263 Score = 34.6 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MSDMIPFNLEHNP-IRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E +R + G+ WF + DVA L ++ Sbjct: 1 MSNISIFNFESTKQVRTAIRNGGDIWFCLPDVANILAISN 40 >gi|71900920|ref|ZP_00683035.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71729332|gb|EAO31448.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 202 Score = 34.6 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGL 35 +IPF+ E++P+R+++ +G WF+ KD+ L Sbjct: 5 SVIPFSFENHPVRVLI-INGEPWFVAKDLCAVL 36 >gi|187477955|ref|YP_785979.1| phage protein [Bordetella avium 197N] gi|115422541|emb|CAJ49066.1| phage protein [Bordetella avium 197N] Length = 374 Score = 34.6 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 FN +P+R+VV D WF+ DV LD+ Sbjct: 60 FNFGDHPVRVVV-RDCEPWFVATDVCAALDY 89 >gi|330985518|gb|EGH83621.1| hypothetical protein PLA107_10890 [Pseudomonas syringae pv. lachrymans str. M301315] Length = 60 Score = 34.6 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGL 35 +S + PF+ P+R+V G F+ KD+A L Sbjct: 26 VSQITPFDFHSFPVRVVDSVQGEPHFIAKDIAEAL 60 >gi|317486781|ref|ZP_07945597.1| phage antirepressor KilAC domain-containing protein [Bilophila wadsworthia 3_1_6] gi|316921944|gb|EFV43214.1| phage antirepressor KilAC domain-containing protein [Bilophila wadsworthia 3_1_6] Length = 258 Score = 34.6 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 1 MSDMIPFN-LEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 MS+M F E +R VV+ DG WF+ KDV L+ T ++ Sbjct: 1 MSEMQIFEKAEFGKVR-VVERDGQPWFVAKDVCECLELTDVS 41 >gi|256850685|ref|ZP_05556110.1| Lj928 prophage antirepressor [Lactobacillus crispatus MV-1A-US] gi|256712553|gb|EEU27549.1| Lj928 prophage antirepressor [Lactobacillus crispatus MV-1A-US] Length = 294 Score = 34.2 bits (77), Expect = 5.3, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+D+ F+ E+ P+RI+ E+ WF+ KD+ L +T Sbjct: 1 MNDLEFFDFENQPVRILKIENEP-WFVGKDLTNILGYT 37 >gi|254361489|ref|ZP_04977628.1| possible bacteriophage antirepressor [Mannheimia haemolytica PHL213] gi|153093003|gb|EDN74024.1| possible bacteriophage antirepressor [Mannheimia haemolytica PHL213] Length = 225 Score = 34.2 bits (77), Expect = 5.3, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN + +R+++D + WF DV L + + Sbjct: 10 FNFNSSAVRVIIDPNQEPWFCGADVCRILGYVN 42 >gi|288573073|ref|ZP_06391430.1| prophage antirepressor [Dethiosulfovibrio peptidovorans DSM 11002] gi|288568814|gb|EFC90371.1| prophage antirepressor [Dethiosulfovibrio peptidovorans DSM 11002] Length = 370 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 SD+ F E +R+V DGN W++ KDV L ++T Sbjct: 112 SDVTLFEFERMVVRVVF-IDGNPWWVAKDVCDILSLGNVT 150 >gi|312873812|ref|ZP_07733856.1| BRO family, N-terminal domain protein [Lactobacillus iners LEAF 2052A-d] gi|311090693|gb|EFQ49093.1| BRO family, N-terminal domain protein [Lactobacillus iners LEAF 2052A-d] Length = 252 Score = 34.2 bits (77), Expect = 5.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 FN E+N +R + + DG +F+ KD+A L +++ Sbjct: 9 FNFENNEVRTL-NIDGKPYFVGKDIAAVLGYSN 40 >gi|300765043|ref|ZP_07075031.1| hypothetical protein LMHG_11509 [Listeria monocytogenes FSL N1-017] gi|300514343|gb|EFK41402.1| hypothetical protein LMHG_11509 [Listeria monocytogenes FSL N1-017] Length = 154 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E N +R V E+ + F+ KDVA L +++ Sbjct: 1 MSNLQIFNFEGNEVRTVFIENEPH-FIGKDVAKVLGYSN 38 >gi|145642457|ref|ZP_01798009.1| hypothetical protein CGSHiR3021_00482 [Haemophilus influenzae R3021] gi|145272850|gb|EDK12744.1| hypothetical protein CGSHiR3021_00482 [Haemophilus influenzae 22.4-21] Length = 67 Score = 34.2 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 F + N +R++ D + WF DV L +++ Sbjct: 10 FTFKSNSVRVITDNNREPWFCANDVCDILGYSN 42 >gi|284800079|ref|ZP_05985661.2| putative antirepressor protein encoded by prophage protein [Neisseria subflava NJ9703] gi|284796123|gb|EFC51470.1| putative antirepressor protein encoded by prophage protein [Neisseria subflava NJ9703] Length = 322 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + + FN N I+ V++++G WF+ +VA L + Sbjct: 45 NSVQSFNFNQNQIQ-VINKNGEAWFIASEVAAMLGY 79 >gi|332344336|gb|AEE57670.1| Anti-repressor protein [Escherichia coli UMNK88] Length = 236 Score = 33.8 bits (76), Expect = 6.9, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 7 FNLEH-NPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 F E NPIR ++ DG WF+ +DV L ++T Sbjct: 9 FKFESVNPIRSII-IDGQPWFVAQDVCSALRIQNVT 43 >gi|298381702|ref|ZP_06991301.1| anti-repressor protein [Escherichia coli FVEC1302] gi|298279144|gb|EFI20658.1| anti-repressor protein [Escherichia coli FVEC1302] Length = 241 Score = 33.8 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 7 FNLEH-NPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 F E NPIR ++ DG WF+ +DV L ++T Sbjct: 14 FKFESVNPIRSII-IDGQPWFVAQDVCSALRIQNVT 48 >gi|167462755|ref|ZP_02327844.1| putative phage antirepressor protein [Paenibacillus larvae subsp. larvae BRL-230010] Length = 264 Score = 33.8 bits (76), Expect = 7.4, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + FN +R+VV +DG+ W++ KDV+ L F Sbjct: 14 MNQLQVFNFTGKDVRVVV-KDGHPWWVAKDVSELLGF 49 >gi|291457579|ref|ZP_06596969.1| toxin-antitoxin system, toxin component, Bro family [Bifidobacterium breve DSM 20213] gi|291380632|gb|EFE88150.1| toxin-antitoxin system, toxin component, Bro family [Bifidobacterium breve DSM 20213] Length = 259 Score = 33.8 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 20/35 (57%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 +++ F+ + +R + DE+G WF+ KDV L Sbjct: 3 TEIQRFDFKGAALRALTDENGEPWFIAKDVCDVLG 37 >gi|254466455|ref|ZP_05079866.1| BRO family, N-terminal domain protein [Rhodobacterales bacterium Y4I] gi|206687363|gb|EDZ47845.1| BRO family, N-terminal domain protein [Rhodobacterales bacterium Y4I] Length = 252 Score = 33.8 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 7 FNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 F+ +R VV DG+ WF+ KDV L Sbjct: 14 FDFNTKQVR-VVSRDGSPWFVAKDVCDALG 42 >gi|300312121|ref|YP_003776213.1| prophage antirepressor protein [Herbaspirillum seropedicae SmR1] gi|300074906|gb|ADJ64305.1| prophage antirepressor protein [Herbaspirillum seropedicae SmR1] Length = 48 Score = 33.8 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%) Query: 5 IPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 IPF+ E IR++ E F+ KD+ LD+++ Sbjct: 4 IPFHFEGRDIRVLASESSEPLFVGKDICEALDYSN 38 >gi|288572745|ref|ZP_06391102.1| prophage antirepressor [Dethiosulfovibrio peptidovorans DSM 11002] gi|288568486|gb|EFC90043.1| prophage antirepressor [Dethiosulfovibrio peptidovorans DSM 11002] Length = 376 Score = 33.8 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 SD+ F E +R+V +GN W++ KDV L + ++ Sbjct: 118 SDVTLFEFERMVVRVVF-INGNPWWVAKDVCDVLGLSDVS 156 >gi|294795001|ref|ZP_06760136.1| toxin-antitoxin system, toxin component, Bro family [Veillonella sp. 3_1_44] gi|294454363|gb|EFG22737.1| toxin-antitoxin system, toxin component, Bro family [Veillonella sp. 3_1_44] Length = 256 Score = 33.8 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+D+ FN + ++++D WF+ KDVA L + Sbjct: 1 MTDLQIFNNDTFGQVRILEKDNELWFVAKDVADTLGY 37 >gi|326562741|gb|EGE13040.1| BRO family protein [Moraxella catarrhalis 103P14B1] Length = 150 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MSDMIPFNLEHNP-IRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E +R + G+ WF + DVA L ++ Sbjct: 1 MSNISIFNFESTKQVRTAIRNGGDIWFCLPDVANILAISN 40 >gi|213692400|ref|YP_002322986.1| phage antirepressor protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213523861|gb|ACJ52608.1| phage antirepressor protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320458542|dbj|BAJ69163.1| putative phage antirepressor [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 259 Score = 33.5 bits (75), Expect = 9.4, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 +++ F+ + +R + DE G WF+ KDV L Sbjct: 3 TEIQRFDFKGAALRTLTDEAGEPWFVAKDVCDILG 37 >gi|326574475|gb|EGE24417.1| BRO family protein [Moraxella catarrhalis 101P30B1] Length = 292 Score = 33.5 bits (75), Expect = 9.8, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MSDMIPFNLEHNP-IRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++ FN E +R + G+ WF + DVA L ++ Sbjct: 1 MSNISIFNFESTKQVRTAIRNGGDIWFCLPDVANILAISN 40 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.316 0.138 0.411 Lambda K H 0.267 0.0433 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 800,409,387 Number of Sequences: 14124377 Number of extensions: 18859151 Number of successful extensions: 47443 Number of sequences better than 10.0: 191 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 91 Number of HSP's that attempted gapping in prelim test: 47205 Number of HSP's gapped (non-prelim): 266 length of query: 41 length of database: 4,842,793,630 effective HSP length: 15 effective length of query: 26 effective length of database: 4,630,927,975 effective search space: 120404127350 effective search space used: 120404127350 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 76 (33.8 bits)