BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 244 bits (623), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 120/120 (100%), Positives = 120/120 (100%) Query: 1 MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRV 60 MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRV Sbjct: 1 MRAKTLLASTLVTTAITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRV 60 Query: 61 KEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY 120 KEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY Sbjct: 61 KEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQNKYQDEMEELSEFGEKVSDY 120 >gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 67.4 bits (163), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%) Query: 1 MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52 M+AK L+ S TT +TI GC +V ED N+++ S +M+KEA ++ E H+LA+E Sbjct: 1 MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60 Query: 53 VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100 VE A +RVKE EE++ A + L +D+L F +L +++ F ++ Sbjct: 61 VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106 >gi|254780978|ref|YP_003065391.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 25.4 bits (54), Expect = 0.36, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 24/50 (48%) Query: 29 IESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAEEQSNARLLKGLGMD 78 I ++ +V + ++ Y+E Q+ + A E+S+ R++ G D Sbjct: 21 ISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARD 70 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 22.7 bits (47), Expect = 2.0, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 84 FMNLDSQNQAFFIDTIQNKY 103 F N Q + FID IQN+Y Sbjct: 591 FANGGKQIRPSFIDRIQNRY 610 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 22.7 bits (47), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Query: 46 HKLAKEYV----EQANQRVKEAEEQSNARLLKGLG--MDD 79 HK+ +EYV E+++ R ++ +S+A + L MDD Sbjct: 112 HKITREYVLYREERSDVRAAQSHSKSDAPIAPKLKIMMDD 151 >gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] Length = 76 Score = 22.3 bits (46), Expect = 3.0, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 69 ARLLKGLGMDDLVRYFMNLDSQ 90 ARL + +G+ ++ YF N DS+ Sbjct: 52 ARLAEAVGVQNVNEYFNNPDSE 73 >gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 21.9 bits (45), Expect = 3.7, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Query: 71 LLKGLGM------DDLVRYFMNLDSQNQAFFIDTIQNK 102 L+ LGM +D++ ++M+L+ Q+ A ++ N+ Sbjct: 113 LMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNR 150 >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 21.9 bits (45), Expect = 3.7, Method: Compositional matrix adjust. Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query: 15 AITIIGCSLVEDNRIESLRMVKEAKMEVLEAHKLAKEYVEQANQRVKEAE----EQSNAR 70 A T++ SL +D+ +E + + A ++ KLA V++ + + AE + N Sbjct: 164 AATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLA 223 Query: 71 LLKGLGM 77 L +G+G+ Sbjct: 224 LSRGMGI 230 >gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Score = 21.2 bits (43), Expect = 5.4, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 87 LDSQNQAF-FIDTIQNKYQDEMEELSEFGEKVSDY 120 LD ++F F+D+++N Y LS+ + + D+ Sbjct: 160 LDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDW 194 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 21.2 bits (43), Expect = 5.6, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 92 QAFF-IDTIQNKYQDEMEELSEFGEKV 117 Q FF I + + D +E LSE+ EKV Sbjct: 191 QWFFKISDLSQELLDSIETLSEWPEKV 217 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 20.4 bits (41), Expect = 9.8, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 44 EAHKLAKEYVEQANQRVKEAEEQSNAR 70 E+H LAK Y E Q + ++ + R Sbjct: 710 ESHSLAKSYSEYREQELNYDRKRISTR 736 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.129 0.334 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,081 Number of Sequences: 1233 Number of extensions: 2135 Number of successful extensions: 23 Number of sequences better than 100.0: 18 Number of HSP's better than 100.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 20 length of query: 120 length of database: 328,796 effective HSP length: 64 effective length of query: 56 effective length of database: 249,884 effective search space: 13993504 effective search space used: 13993504 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 33 (17.3 bits)