>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex. Decapping is a key step in both general and nonsense-mediated 5'-3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).

Probab=99.78 E-value=9.6e-19 Score=129.55 Aligned_cols=109 Identities=28% Similarity=0.375 Sum_probs=74.5 Q ss_pred CEEEEEEECCC-CCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCC Q ss_conf 60699998489-83999992688776668722012115078888889999999998375522222013661241163222 Q gi|254780557|r 4 RGVGILILNQD-DLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHC 82 (160) Q Consensus 4 ~~V~vvi~n~~-~~iLl~kR~~~~~~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGi~~~~~~~~~~~~~~~~~~~~~ 82 (160) T Consensus 2 Pv~GaIiln~~~~kvLLVk~~~------~~~W~fPkGki~~~E~~~~~AiREv~EEtG~Dv~~~i~~~----------~~ 65 (145) T cd03672 2 PVYGAIILNEDLDKVLLVKGWK------SKSWSFPKGKINKDEDDHDCAIREVYEETGFDISKYIDKD----------DY 65 (145) T ss_pred CEEEEEEEECCCCEEEEEEECC------CCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCC----------EE T ss_conf 7259999918999899999438------9958599641689979899998887773275754215846----------06 Q ss_pred CCCCCCCCCCCEEEEEEECCCCCCEECCCCCCCCCCCCCEEEECCHHHHHHC Q ss_conf 0000112344337999980475430105788888886003760378997630 Q gi|254780557|r 83 IQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNI 134 (160) Q Consensus 83 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~E~~~~~Wv~~~el~~~ 134 (160) T Consensus 66 Ie-~~~~~q~~rlyiv~gVp~dt~F~-----p~TRkEI~~I~W~~i~~Lp~~ 111 (145) T cd03672 66 IE-LIIRGQNVKLYIVPGVPEDTPFE-----PKTRKEISKIEWFDIKDLPTK 111 (145) T ss_pred EE-EEECCEEEEEEEECCCCCCCCCC-----CCCCCCEEEEEEEEHHHHHHH T ss_conf 99-99789089999982888887517-----887232765788898884444

HHsearch alignment for GI: 254780557 and conserved domain: cd03672