RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >gnl|CDD|72891 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily. Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variations. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies.. Length = 147 Score = 157 bits (398), Expect = 1e-39 Identities = 63/155 (40%), Positives = 86/155 (55%), Gaps = 13/155 (8%) Query: 1 MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETG 60 YR VG+++ N+D V+VGRR WQ PQGGI+ EDP AA REL EETG Sbjct: 1 PYRPNVGVVLFNEDGKVFVGRRIDTPG-----AWQFPQGGIDEGEDPEQAALRELEEETG 55 Query: 61 IK--SISLLGQGDSYIQYDFPAHC---IQENGYVGQMQKWFAFRFQGLTSEICVDRTAYG 115 + S+ ++ + +++YD P I Y GQ QKWF FRF G SEI ++ Sbjct: 56 LDPDSVEIIAEIPDWLRYDLPPELKLKIWGGRYRGQEQKWFLFRFTGDDSEIDLNAPE-- 113 Query: 116 YESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADF 150 EFD W WV L + P+++V FK+ Y V+ +F Sbjct: 114 -HPEFDEWRWVPLEELPDLIVPFKRPVYEAVLKEF 147 >gnl|CDD|144032 pfam00293, NUDIX, NUDIX domain. Length = 133 Score = 83.7 bits (207), Expect = 2e-17 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 17/149 (11%) Query: 2 YRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 RR VG+++LN+D V + RR LW++P G + P E P +AA REL EETG+ Sbjct: 1 RRRAVGVVLLNEDGEVLLVRR--SRTPGTPGLWELPGGKVEPGESPEEAAVRELEEETGL 58 Query: 62 KSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFD 121 + + LL G ++Y P ++E F G E D E Sbjct: 59 RVLLLLLLG--VLEYPAPGRDLRE------HVHVFLAELLGGEPEPQPDPG------EVS 104 Query: 122 AWTWVSLWDTPNIVVDFK-KEAYRQVVAD 149 WV L + +++ + +E ++A Sbjct: 105 EVRWVPLEELLELLLAGEIREVIALLLAL 133 >gnl|CDD|30840 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]. Length = 161 Score = 60.0 bits (143), Expect = 2e-10 Identities = 32/161 (19%), Positives = 58/161 (36%), Gaps = 8/161 (4%) Query: 1 MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPL-DAAYRELYEET 59 R V + +L D G LW++P G + P E+ +AA REL EET Sbjct: 7 RKVRDVAVAVLVGRD--GPGEVLLAQRRDDGGLWELPGGKVEPGEELPEEAAARELEEET 64 Query: 60 GIKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESE 119 G++ + + +FP + G+ + F + + ++ + E E Sbjct: 65 GLR----VKDERLELLGEFPPSPGDGSSVGGREHRVFFVAEVDDSLAVAIEGLSAPSE-E 119 Query: 120 FDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG 160 + WV L + +V+ + A L + Sbjct: 120 LEDLEWVPLDELAALVLAEDQVKRDAKKALLLLLFLALKRK 160 >gnl|CDD|72880 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.. Length = 123 Score = 59.1 bits (142), Expect = 6e-10 Identities = 31/125 (24%), Positives = 46/125 (36%), Gaps = 19/125 (15%) Query: 4 RGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKS 63 VG +IL++D V + RR W++P GG+ P E +AA RE+ EETG+ Sbjct: 1 VAVGAVILDEDGRVLLVRRADSPGGL----WELPGGGVEPGETLEEAAIREVREETGLDV 56 Query: 64 ISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAW 123 L G ++ + F R G + E Sbjct: 57 DVLRLLGVYEVESPDEGE--------HAVVFVFLARLVGGEPTLLPPD-------EISEV 101 Query: 124 TWVSL 128 WV+L Sbjct: 102 RWVTL 106 >gnl|CDD|72906 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 127 Score = 51.8 bits (124), Expect = 9e-08 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 24/126 (19%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKS- 63 GVG L+LN+ + V V + + NK + W++P G ++P ED D A RE+ EETGI + Sbjct: 4 GVGGLVLNEKNEVLVVQ----ERNKTPNGWKLPGGLVDPGEDIFDGAVREVLEETGIDTE 59 Query: 64 -ISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDA 122 +S++G G G+ +F R + L+ +I D SE A Sbjct: 60 FVSVVGF------------RHAHPGAFGKSDLYFICRLKPLSFDINFD------TSEIAA 101 Query: 123 WTWVSL 128 W+ L Sbjct: 102 AKWMPL 107 >gnl|CDD|72882 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.. Length = 137 Score = 50.6 bits (121), Expect = 2e-07 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSI 64 V +L + D V + R+ L ++P G I+P EDP +AA REL EETG ++ Sbjct: 4 AVAVLPYDDDGKVVLVRQYRPPVGGWL--LELPAGLIDPGEDPEEAARRELEEETGYEAG 61 Query: 65 SLLGQGDSY 73 L G Y Sbjct: 62 DLEKLGSFY 70 >gnl|CDD|31251 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]. Length = 145 Score = 50.4 bits (120), Expect = 2e-07 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 VG LI+ ++ V R N W +P G + E +AA REL EETG++ Sbjct: 10 LVAVGALIVRNGRILLVRRA----NEPGAGYWALPGGFVEIGETLEEAARRELKEETGLR 65 >gnl|CDD|72894 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 138 Score = 50.3 bits (120), Expect = 3e-07 Identities = 37/120 (30%), Positives = 48/120 (40%), Gaps = 10/120 (8%) Query: 31 LSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGYVG 90 L W P G I+P E L+AA REL EETG I LLG + D H I + G Sbjct: 25 LGSWLQPGGHIDPDESLLEAALRELREETG---IELLGLRPLSVLVDLDVHPIDGHPKRG 81 Query: 91 QMQKW-FAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVAD 149 RF + D A E DA W L + ++ + E R++V Sbjct: 82 VPGHLHLDLRFLAVAPA---DDVAPPKSDESDAVRWFPLDELASLELP---EDVRRLVEK 135 >gnl|CDD|72901 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 129 Score = 50.3 bits (120), Expect = 3e-07 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 16/106 (15%) Query: 24 FHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK--SISLLGQGDSYIQYDFPAH 81 ++K+ WQ GGI E P +AA RE+ EETG+ ++LL +G S +F Sbjct: 20 LRRSDKYAGFWQSVTGGIEDGESPAEAARREVAEETGLDPERLTLLDRGASIAFVEF-TD 78 Query: 82 CIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVS 127 + + FAF + E DA+ WV Sbjct: 79 NGRVW-----TEHPFAFH--------LPSDAVVTLDWEHDAFEWVP 111 >gnl|CDD|72904 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 112 Score = 49.5 bits (118), Expect = 4e-07 Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 9/68 (13%) Query: 23 CFHDNN-----KHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLG----QGDSY 73 C K S W +P G I P E PL AA REL EETG++ + LL G S Sbjct: 7 CRRGGRVLLVRKSGSRWALPGGKIEPGETPLQAARRELQEETGLQGLDLLYLFHVDGGST 66 Query: 74 IQYDFPAH 81 + F A Sbjct: 67 RHHVFVAS 74 >gnl|CDD|35867 KOG0648, KOG0648, KOG0648, Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms]. Length = 295 Score = 48.1 bits (114), Expect = 1e-06 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 R GVG +LN+ V V + K W++P G + ED A RE+ EETGI Sbjct: 115 RVGVGAFVLNKKKEVLV-VQEKDGAVKIRGGWKLPTGRVEEGEDIWHGAVREVKEETGID 173 Query: 63 S 63 + Sbjct: 174 T 174 >gnl|CDD|72919 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 128 Score = 47.2 bits (112), Expect = 2e-06 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETG--IKSISLLGQGDSYIQ---YDFPAH 81 W +P GGI P E P +A +RE+ EETG ++ LG Y D+ AH Sbjct: 26 RWDLPGGGIEPGESPEEALHREVLEETGLTVEIGRRLGSASRYFYSPDGDYDAH 79 >gnl|CDD|72913 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 129 Score = 46.4 bits (110), Expect = 4e-06 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 R GVG+ +LN V +G+R + W +P G + E + A RE+ EETG+ Sbjct: 2 RVGVGVFVLNPKGKVLLGKRK---GSHGAGTWALPGGHLEFGESFEECAAREVLEETGLH 58 >gnl|CDD|72911 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 129 Score = 46.0 bits (109), Expect = 5e-06 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 GV ++ + + V + RR DN LW +P G + P E P D A RE+ EETG+ Sbjct: 4 GVTAVVRDDEGRVLLIRR--SDNG----LWALPGGAVEPGESPADTAVREVREETGL 54 >gnl|CDD|72883 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi). This enzyme requires two divalent cations for activity; one coordinates the phosphoryl groups of the NTP/dNTP substrate, and the other coordinates to the enzyme. It also contains the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as metal binding and catalytic site. MutT pyrophosphohydrolase is important in preventing errors in DNA replication by hydrolyzing mutagenic nucleotides such as 8-oxo-dGTP (a product of oxidative damage), which can mispair with template adenine during DNA replication, to guanine nucleotides.. Length = 124 Score = 45.5 bits (108), Expect = 6e-06 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Query: 6 VGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 V +I++ D + + +R LW+ P G + P E P A REL EE GI+ Sbjct: 4 VAAIIIDDDGRILIAQR--PAGKHLGGLWEFPGGKVEPGETPEQALVRELREELGIE 58 >gnl|CDD|72915 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 120 Score = 44.5 bits (105), Expect = 1e-05 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Query: 4 RGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 G ++ + D V + R + W +P GG+ E +AA REL EE GI+ Sbjct: 1 LGARAVVTDADGRVLLVRHTYGP------GWYLPGGGLERGETFAEAARRELLEELGIR 53 >gnl|CDD|72912 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 132 Score = 44.0 bits (104), Expect = 2e-05 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSI 64 G G+++LN+ V + +R D W +P G + E + A REL EETG++ Sbjct: 9 GAGVILLNEQGEVLLQKR--SDTGD----WGLPGGAMELGESLEETARRELKEETGLEVE 62 Query: 65 SL 66 L Sbjct: 63 EL 64 >gnl|CDD|72886 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily. Ap4A hydrolases are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one subfamily and fungi/animals/archaea enzymes, represented by this subfamily, fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val) that functions as a metal binding and catalytic site, and a required divalent cation, Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variation. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies.. Length = 130 Score = 43.3 bits (102), Expect = 3e-05 Identities = 16/30 (53%), Positives = 20/30 (66%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKS 63 W P+G + P ED L+AA RE EETGI + Sbjct: 29 WDFPKGHVEPGEDDLEAALRETEEETGITA 58 >gnl|CDD|72920 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 133 Score = 43.4 bits (102), Expect = 3e-05 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 8 ILILNQDDLVWVGRRCFHD-NNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISL 66 +++L+ DD V + R D ++ W P GG+ P E P AA REL EETGI L Sbjct: 5 VVLLDPDDRVLLLR--GDDPDSPGPDWWFTPGGGVEPGESPEQAARRELREETGITVADL 62 Query: 67 LGQ 69 Sbjct: 63 GPP 65 >gnl|CDD|72909 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 122 Score = 43.3 bits (102), Expect = 3e-05 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 VG ++ ++ V R N LW P G + E AA REL EETG+ Sbjct: 2 AVGAVVFRGGRVLLVRRA----NPPDAGLWSFPGGKVELGETLEQAALRELLEETGL 54 >gnl|CDD|72905 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 121 Score = 43.0 bits (101), Expect = 4e-05 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 9/84 (10%) Query: 4 RGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI-- 61 R ++I +Q +++ + R K + P GGI E P +AA RE EE G+ Sbjct: 2 RASIVIINDQGEILLIRR---IKPGKTY--YVFPGGGIEEGETPEEAAKREALEELGLDV 56 Query: 62 --KSISLLGQGDSYIQYDFPAHCI 83 + I L+ + ++ F A I Sbjct: 57 RVEEIFLIVNQNGRTEHYFLARVI 80 >gnl|CDD|72917 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 122 Score = 42.6 bits (100), Expect = 4e-05 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 6/61 (9%) Query: 4 RGVGILILNQDDLVWVGRRCFHDNNKHLS---LWQMPQGGINPQEDPLDAAYRELYEETG 60 GV + +L D + + R D+ + W +P G E PL+ REL EE G Sbjct: 1 SGVALALLIGDGRLLLQLR---DDKPGIPYPGHWDLPGGHREGGETPLECVLRELLEEIG 57 Query: 61 I 61 + Sbjct: 58 L 58 >gnl|CDD|72916 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 130 Score = 42.6 bits (100), Expect = 5e-05 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Query: 6 VGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK--S 63 VG+LILN+D + V RR +P G ++P E +A RE+ EETG+K Sbjct: 4 VGVLILNEDGELLVVRRAR---EPGKGTLDLPGGFVDPGESAEEALIREIREETGLKVTE 60 Query: 64 ISLLGQG-DSYIQYDFPAHCI 83 +S L ++Y + Sbjct: 61 LSYLFSLPNTYPYGGMEYDTL 81 >gnl|CDD|72892 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex. Decapping is a key step in both general and nonsense-mediated 5'->3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).. Length = 145 Score = 41.7 bits (98), Expect = 1e-04 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQ 75 W P+G IN ED D A RE+YEETG IS D YI+ Sbjct: 27 WSFPKGKINKDEDDHDCAIREVYEETGF-DISKYIDKDDYIE 67 >gnl|CDD|72893 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily. Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most preferred substrate, hydrolyzes to produce two ATP molecules, which is a novel hydrolysis mode for Ap6A. These results indicate that Ap6A hydrolase is a diadenosine polyphosphate hydrolase. It requires the presence of a divalent cation, such as Mn2+, Mg2+, Zn2+, and Co2+, for activity. Members of the Nudix superfamily are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site.. Length = 131 Score = 41.4 bits (97), Expect = 1e-04 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAH 81 W +P+G + P E P +AA RE+ EETGI+ + +G I+Y F + Sbjct: 29 WSLPKGKLEPGETPPEAAVREVEEETGIR--AEVGDPLGTIRYWFSSS 74 >gnl|CDD|72934 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities. Like other enzymes belonging to this superfamily, it requires a divalent cation, in this case Mg2+, for its activity. It also contains a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. In general, substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 142 Score = 40.8 bits (95), Expect = 2e-04 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Query: 4 RGVGILILNQD-DLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 R G +ILN+ D++ V + LW +P G + E P DAA RE EETG++ Sbjct: 14 RAAGAVILNERNDVLLVQEKGGPKKG----LWHIPSGAVEDGEFPQDAAVREACEETGLR 69 >gnl|CDD|72899 cd04662, Nudix_Hydrolase_5, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 126 Score = 40.7 bits (95), Expect = 2e-04 Identities = 18/35 (51%), Positives = 20/35 (57%) Query: 28 NKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 NK L W +P+G EDPL AA RE EETG Sbjct: 29 NKDLGAWSIPKGEYTEGEDPLLAAKREFSEETGFC 63 >gnl|CDD|38050 KOG2839, KOG2839, KOG2839, Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms]. Length = 145 Score = 40.3 bits (94), Expect = 2e-04 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Query: 29 KHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCIQENGY 88 K W +P+GG P E +AA RE +EE G+K G + H + G Sbjct: 33 KKPHRWIVPKGGWEPDESVEEAALRETWEEAGVKGKLGRLLGGFE-DFLSKKHRTKPKGV 91 Query: 89 V 89 + Sbjct: 92 M 92 >gnl|CDD|72933 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 129 Score = 39.1 bits (91), Expect = 6e-04 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHL-SLWQMPQGGINPQEDPLDAAYRELYEETGI 61 V LI+ + + +R + + W++P G + E +A RE+YEETG+ Sbjct: 3 AVAALIVKDVGRILILKR--SKDERTAPGKWELPGGKVEEGETFEEALKREVYEETGL 58 >gnl|CDD|72903 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 122 Score = 38.7 bits (90), Expect = 8e-04 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIK 62 W +P+GG E P +AA RE +EE G++ Sbjct: 28 WIVPKGGPEKDESPAEAAAREAWEEAGVR 56 >gnl|CDD|33876 COG4119, COG4119, Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only]. Length = 161 Score = 38.5 bits (89), Expect = 8e-04 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 11/64 (17%) Query: 1 MYRRGVG---ILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYE 57 +YR G +L+++ W K W +P+G EDP AA RE E Sbjct: 10 LYRARAGVVDVLLVHPGGPFWA--------GKDDGAWSIPKGEYTGGEDPWLAARREFSE 61 Query: 58 ETGI 61 E GI Sbjct: 62 EIGI 65 >gnl|CDD|72925 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 118 Score = 37.9 bits (88), Expect = 0.001 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGI----KSISLLGQGD 71 + +P G I E PL A REL EE G+ S+ LG Sbjct: 25 FYLPGGKIEAGETPLQALIRELSEELGLDLDPDSLEYLGTFR 66 >gnl|CDD|72885 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily. MTH1, the mammalian counterpart of MutT, hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates, thereby preventing the incorporation of such oxygen radicals during replication. This is an important step in the repair mechanism in genomic and mitochondrial DNA. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity, and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. MTH1 is predominantly localized in the cytoplasm and mitochondria. Structurally, this enzyme adopts a similar fold to MutT despite low sequence similarity outside the conserved nudix motif. The most distinctive structural difference between MutT and MTH1 is the presence of a beta-hairpin, which is absent in MutT. This results in a much deeper and narrower substrate binding pocket. Mechanistically, MTH1 contains dual specificity for nucleotides that contain 2-OH-adenine bases and those that contain 8-oxo-guanine bases.. Length = 137 Score = 37.8 bits (88), Expect = 0.001 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 10/62 (16%) Query: 30 HLSLWQMPQGGINPQEDPLDAAYRELYEET----------GIKSISLLGQGDSYIQYDFP 79 W P G + P E P + A REL EET GI G+ + Y + F Sbjct: 24 GWGGWNGPGGKVEPGETPEECAIRELKEETGLTIDNLKLVGIIKFPFPGEEERYGVFVFL 83 Query: 80 AH 81 A Sbjct: 84 AT 85 >gnl|CDD|72921 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 131 Score = 37.6 bits (87), Expect = 0.002 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 7/72 (9%) Query: 10 ILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQ 69 I+ Q D + + + ++ P GG+ ED ++ REL EETG +I ++ + Sbjct: 6 IILQGDKILL----LYTKRYGD--YKFPGGGVEKGEDHIEGLIRELQEETGATNIRVIEK 59 Query: 70 GDSYIQYDFPAH 81 +Y + P Sbjct: 60 FGTYTERR-PWR 70 >gnl|CDD|72902 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 118 Score = 37.2 bits (86), Expect = 0.002 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIK--SISLLGQ 69 W+ P G + P E +AA RE++EETG + S++L+G Sbjct: 23 WEFPGGHVEPGETIEEAARREVWEETGAELGSLTLVGY 60 >gnl|CDD|72918 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 120 Score = 37.2 bits (86), Expect = 0.002 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 9 LILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 ++L +DD V + RR W +P G + ED + AA RE EE G+ Sbjct: 5 VLLRRDDEVLLQRRANTGYMDGQ--WALPAGHLEKGEDAVTAAVREAREEIGV 55 >gnl|CDD|72929 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 143 Score = 36.9 bits (85), Expect = 0.003 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 7/74 (9%) Query: 5 GVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI--- 61 GV +L+ + D + + RR ++W P G + E+ L+A REL EETG+ Sbjct: 3 GVAVLLQSSDQKLLLTRRASSLRI-FPNVWVPPGGHVELGENLLEAGLRELNEETGLTLD 61 Query: 62 ---KSISLLGQGDS 72 KS +LG +S Sbjct: 62 PIDKSWQVLGLWES 75 >gnl|CDD|72884 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.. Length = 157 Score = 36.7 bits (85), Expect = 0.003 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Query: 21 RRCFHDNNKHLSLWQMPQGGINP-QEDPLDAAYRELYEETGI--KSISLLGQGDSYI 74 +R H + H P G ++P EDP+ A RE EE G+ S+ +LG+ Y Sbjct: 22 KRASHLRS-HPGQVAFPGGKVDPGDEDPVATALREAEEEIGLPPDSVEVLGRLPPYY 77 >gnl|CDD|38251 KOG3041, KOG3041, KOG3041, Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair]. Length = 225 Score = 36.5 bits (84), Expect = 0.003 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 35 QMPQGGINPQEDPLDAAYRELYEETGIK 62 ++P G I+ ED AA REL EETG K Sbjct: 106 ELPAGLIDDGEDFEGAAIRELEEETGYK 133 >gnl|CDD|72907 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 123 Score = 35.3 bits (81), Expect = 0.009 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKS-----ISLLGQGDSYIQYDFPAHCI 83 W +P G + P E +A RE+ EETG+ +S+ QG S+ ++ F + Sbjct: 28 WYLPAGRMEPGETIEEAVKREVKEETGLDCEPTTLLSVEEQGGSWFRFVFTGNIT 82 >gnl|CDD|72895 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 134 Score = 34.4 bits (79), Expect = 0.014 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGI 61 ++ P G + P E ++AA RE EETG Sbjct: 25 VFNQPAGHLEPGESLIEAAVRETLEETGW 53 >gnl|CDD|72910 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 118 Score = 34.2 bits (78), Expect = 0.018 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Query: 6 VGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 V + +L DD + V RR +P G I E DA REL EETG+ Sbjct: 6 VVVALLPVDDGLLVIRR---GIEPGRGKLALPGGFIELGETWQDAVARELLEETGV 58 >gnl|CDD|72900 cd04663, Nudix_Hydrolase_6, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belong to this superfamily requires a divalent cation, such as Mg2+ or Mn2+ for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V) which functions as metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 126 Score = 33.4 bits (76), Expect = 0.026 Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 35 QMPQGGINPQEDPLDAAYRELYEETGIKSIS 65 Q+ +G + P E P AA REL EE+G+ S Sbjct: 27 QIVKGTVEPGETPEAAALRELQEESGLPSFL 57 >gnl|CDD|38294 KOG3084, KOG3084, KOG3084, NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]. Length = 345 Score = 33.1 bits (75), Expect = 0.038 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGIK 62 LW G + P E +A RE +EETGI+ Sbjct: 214 LWTCLAGFLEPGESIEEAVRRETWEETGIE 243 >gnl|CDD|72926 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 117 Score = 32.2 bits (73), Expect = 0.062 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Query: 8 ILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSIS 65 + +L DD V + RR N +P G I E +A RE+ EE G+ +S Sbjct: 4 VGVLFSDDKVLLERRSLTKNADP-GKLNIPGGHIEAGESQEEALLREVQEELGVDPLS 60 >gnl|CDD|72922 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 128 Score = 32.2 bits (73), Expect = 0.070 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 R +I+ D ++ + HD+ + +P GG P E DAA+RE EE GI Sbjct: 1 RNSAKAVIIKNDKILLIK---HHDDGG--VWYILPGGGQEPGETLEDAAHRECKEEIGI 54 >gnl|CDD|72914 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 125 Score = 31.8 bits (72), Expect = 0.089 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 6/83 (7%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETG-- 60 R G G IL D + + +R H W +P G ++ E DA RE+ EETG Sbjct: 2 RVGCGAAILRDDGKLLLVKRLRAPEAGH---WGIPGGKVDWMEAVEDAVVREIEEETGLS 58 Query: 61 IKSISLLGQGDSYIQYDFPAHCI 83 I S LL D I+ P H + Sbjct: 59 IHSTRLLCVVDHIIEEP-PQHWV 80 >gnl|CDD|72931 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 125 Score = 30.6 bits (69), Expect = 0.22 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 6 VGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 VG LI D + + R K LW +P G + E +A RE EETG+K Sbjct: 5 VGALIYAPDGRILLVR-----TTKWRGLWGVPGGKVEWGETLEEALKREFREETGLK 56 >gnl|CDD|72923 cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 126 Score = 29.4 bits (66), Expect = 0.42 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Query: 23 CFHDN------NKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 H+ N + ++ P GGI E +A RE EE G+K Sbjct: 8 IIHNGKLLVQKNPDETFYRPPGGGIEFGESSEEALIREFKEELGLK 53 >gnl|CDD|72932 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 126 Score = 29.5 bits (66), Expect = 0.45 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 4/69 (5%) Query: 4 RGVGILILNQDDLVWVGRRCFHDNNKHL-SLWQMPQGG-INPQEDPLDAAYRELYEETGI 61 R I + N + + V +R W + GG + E L A REL EE GI Sbjct: 1 RATYIFVFNSEGKLCVHKR--TLTKDWCPGYWDIAFGGVVQAGESYLQNAQRELEEELGI 58 Query: 62 KSISLLGQG 70 + L G Sbjct: 59 DGVQLTPLG 67 >gnl|CDD|72930 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 131 Score = 28.7 bits (64), Expect = 0.67 Identities = 15/33 (45%), Positives = 16/33 (48%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKSISL 66 W GG+ E AA REL EETGI L Sbjct: 29 WCHVAGGVEAGETAWQAALRELKEETGISLPEL 61 >gnl|CDD|72908 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 123 Score = 28.6 bits (64), Expect = 0.91 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGIK 62 LW +P G + P + +E+ EETG+ Sbjct: 25 LWSLPGGWADVGLSPAENVVKEVKEETGLD 54 >gnl|CDD|36226 KOG1008, KOG1008, KOG1008, Uncharacterized conserved protein, contains WD40 repeats [Function unknown]. Length = 783 Score = 28.1 bits (62), Expect = 1.3 Identities = 23/117 (19%), Positives = 39/117 (33%), Gaps = 25/117 (21%) Query: 25 HDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSIS------LLGQG---DSYIQ 75 H N+ L +W + P+E PL ++ G S+ L+ G S Sbjct: 125 HRNDSSLKIWDINSLLTVPKESPLFSSSTLD----GQNSVCWLRDTKLVLAGMTSRSVHI 180 Query: 76 YDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTP 132 +D + + QG+T VD + Y +++WDT Sbjct: 181 FDLRQSLDSVSSVNTKY-------VQGIT----VDPFSPNYFCSNSD-GDIAIWDTY 225 >gnl|CDD|72927 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 144 Score = 27.9 bits (62), Expect = 1.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 39 GGINPQEDPLDAAYRELYEETGIK 62 G I E PL+ REL EE G+ Sbjct: 41 GHILAGETPLEDGIRELEEELGLD 64 >gnl|CDD|72896 cd03676, Nudix_hydrolase_3, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belong to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 180 Score = 27.5 bits (61), Expect = 1.6 Identities = 12/45 (26%), Positives = 19/45 (42%) Query: 17 VWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 +W+ RR L + GG+ E P + +E EE G+ Sbjct: 50 IWIPRRSPTKATWPGMLDNLVAGGLGHGEGPEETLVKECDEEAGL 94 >gnl|CDD|38148 KOG2937, KOG2937, KOG2937, Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification]. Length = 348 Score = 27.3 bits (60), Expect = 2.0 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDF 78 W P+G I+ E D A RE+ EETG L + I+ + Sbjct: 108 WSFPRGKISKDESDSDCAIREVTEETGFDYSKQLQD-NEGIETNI 151 >gnl|CDD|35377 KOG0155, KOG0155, KOG0155, Transcription factor CA150 [Transcription]. Length = 617 Score = 27.4 bits (60), Expect = 2.1 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Query: 16 LVWVG--RRCFHDNNKHLSLWQMP 37 +VW G R F++ LS+W+ P Sbjct: 118 VVWTGDNRVFFYNPKTKLSVWERP 141 >gnl|CDD|72887 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity. Members of this family are also recognized by the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. A block of 8 conserved amino acids downstream of the nudix motif is thought to give NADH pyrophosphatase its specificity for NADH. NADH pyrophosphatase forms a dimer.. Length = 131 Score = 27.0 bits (60), Expect = 2.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 39 GGINPQEDPLDAAYRELYEETGIK 62 G + P E +A RE+ EE GI+ Sbjct: 32 GFVEPGESLEEAVRREVKEEVGIR 55 >gnl|CDD|72897 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.. Length = 130 Score = 26.7 bits (59), Expect = 2.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETG 60 W +P G + E A RE +EE G Sbjct: 39 FWTLPAGFMENGETTEQGALRETWEEAG 66 >gnl|CDD|36285 KOG1067, KOG1067, KOG1067, Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only]. Length = 760 Score = 26.5 bits (58), Expect = 3.1 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 58 ETGIKSISLLG---QGDSYIQYDFPAHCIQENGYVG 90 E+ K SL+G + + Y+FP + E G +G Sbjct: 404 ESAQKLDSLIGPDNGINFMLHYEFPPYATNEVGKIG 439 >gnl|CDD|72881 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway. Isoprenoids comprise a large family of natural products including sterols, carotenoids, dolichols and prenylated proteins. These compounds are synthesized from two precursors: isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). IPP isomerase catalyzes the interconversion of IPP and DMAPP by a stereoselective antarafacial transposition of hydrogen. The enzyme requires one Mn2+ or Mg2+ ion in its active site to fold into an active conformation and also contains the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. The metal binding site is present within the active site and plays structural and catalytical roles. IPP isomerase is well represented in several bacteria, archaebacteria and eukaryotes, including fungi, mammals and plants. Despite sequence variations (mainly at the N-terminus), the core structure is highly conserved.. Length = 165 Score = 25.9 bits (57), Expect = 5.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Query: 43 PQEDPLDAAYRELYEETGIK 62 P E DAA R L EE GI Sbjct: 70 PGEGVKDAAQRRLREELGIT 89 >gnl|CDD|37728 KOG2517, KOG2517, KOG2517, Ribulose kinase and related carbohydrate kinases [Carbohydrate transport and metabolism]. Length = 516 Score = 26.0 bits (57), Expect = 5.1 Identities = 13/42 (30%), Positives = 14/42 (33%), Gaps = 2/42 (4%) Query: 90 GQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDT 131 G W A G +S C D T F T LWD Sbjct: 171 GTFDTWLATGLTGRSSCHCTDVTNASRTGLF--NTESGLWDL 210 >gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however. Length = 312 Score = 25.6 bits (57), Expect = 5.8 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Query: 43 PQEDPLDAAYRELYEE---TGIKSISLLGQGDSY 73 PQ D L A + + G+K+++ +G D+Y Sbjct: 114 PQNDRLMAEA--ILADMKKRGVKTVAFIGFSDAY 145 >gnl|CDD|153079 cd07932, arginine_kinase_like, Phosphagen (guanidino) kinases such as arginine kinase and similar enzymes. Eukaryotic arginine kinase-like phosphagen (guanidino) kinases are enzymes that transphosphorylate a high energy phosphoguanidino compound, like phosphoarginine in the case of arginine kinase (AK), which is used as an energy-storage and -transport metabolite, to ADP, thereby creating ATP. The substrate binding site is located in the cleft between the N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain. Besides AK, one of the most studied members of this family, this model also represents a phosphagen kinase with different substrate specificity, hypotaurocyamine kinase (HTK). Length = 350 Score = 25.4 bits (56), Expect = 7.2 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 19/59 (32%) Query: 18 W-VGRRCFHDNNK----------HLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSIS 65 W GR FH+++K HL + M +GG L A Y+ L T +K + Sbjct: 198 WPTGRGIFHNDDKTFLVWVNEEDHLRIISMQKGG------DLGAVYKRLV--TALKELE 248 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.140 0.457 Gapped Lambda K H 0.267 0.0641 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,145,065 Number of extensions: 106909 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 239 Number of HSP's successfully gapped: 65 Length of query: 160 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 74 Effective length of database: 4,405,363 Effective search space: 325996862 Effective search space used: 325996862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.4 bits)