RPSBLAST alignment for GI: 254780559 and conserved domain: COG1136

>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226
 Score =  158 bits (401), Expect = 1e-39
 Identities = 74/221 (33%), Positives = 121/221 (54%), Gaps = 14/221 (6%)

Query: 1   MIKLDHLIYCYDNLKMQ------FDFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRG 54
           MI+L ++   Y     +       + ++   E + I+GPSG+GKSTLL+L+ G   PT G
Sbjct: 1   MIELKNVSKIYGLGGEKVEALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLDKPTSG 60

Query: 55  SIFLNGQNHTRSSPSKRP------LSILFQENNLFSHLTVWQNIALGIAPNLRLDHYQHA 108
            + +NG++ T+ S  +        +  +FQ  NL   LTV +N+ L +    +    +  
Sbjct: 61  EVLINGKDLTKLSEKELAKLRRKKIGFVFQNFNLLPDLTVLENVELPLLIAGKSAGRRKR 120

Query: 109 QVKQMLEKVFLEDFFN-RFPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHE 167
             +++LE + LED    + PS++SGGQ+QRVA+AR LI    I+L DEP    D     E
Sbjct: 121 AAEELLEVLGLEDRLLKKKPSELSGGQQQRVAIARALINNPKIILADEPTGNLDSKTAKE 180

Query: 168 ILGLLKQVCDERQLTLLMISHNLEDSMQIATRFIVIAGGQI 208
           +L LL+++  ER  T++M++H+ E   + A R I +  G+I
Sbjct: 181 VLELLRELNKERGKTIIMVTHDPE-LAKYADRVIELKDGKI 220