RPSBLAST alignment for GI: 254780559 and conserved domain: cd03258

>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 233
 Score =  163 bits (413), Expect = 5e-41
 Identities = 77/228 (33%), Positives = 122/228 (53%), Gaps = 19/228 (8%)

Query: 1   MIKLDHLIYCYDNLKMQF------DFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRG 54
           MI+L ++   + +   +          V K E   I+G SGAGKSTL+  + G + PT G
Sbjct: 1   MIELKNVSKVFGDTGGKVTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLERPTSG 60

Query: 55  SIFLNGQNHTRSSPSK-----RPLSILFQENNLFSHLTVWQNIALGIAPNLRLDH----Y 105
           S+ ++G + T  S  +     R + ++FQ  NL S  TV++N+AL     L +       
Sbjct: 61  SVLVDGTDLTLLSGKELRKARRRIGMIFQHFNLLSSRTVFENVALP----LEIAGVPKAE 116

Query: 106 QHAQVKQMLEKVFLEDFFNRFPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALR 165
              +V ++LE V LED  + +P+Q+SGGQ+QRV +AR L     +LL DE  +  DP   
Sbjct: 117 IEERVLELLELVGLEDKADAYPAQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETT 176

Query: 166 HEILGLLKQVCDERQLTLLMISHNLEDSMQIATRFIVIAGGQIVYDGD 213
             IL LL+ +  E  LT+++I+H +E   +I  R  V+  G++V +G 
Sbjct: 177 QSILALLRDINRELGLTIVLITHEMEVVKRICDRVAVMEKGEVVEEGT 224