RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >gnl|CDD|145515 pfam02410, DUF143, Domain of unknown function DUF143. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 100 amino acids long. Length = 99 Score = 59.1 bits (144), Expect = 3e-10 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + +++ L + KAEDI + + S +S I D VI +G S +HV +IADN+ LK+ Sbjct: 2 LELIVKALDDKKAEDIVVL-DVSEKSSIADYFVIATGTSDRHVKAIADNVEEELKEAG 58 >gnl|CDD|31142 COG0799, COG0799, Uncharacterized homolog of plant Iojap protein [Function unknown]. Length = 115 Score = 54.9 bits (132), Expect = 5e-09 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++E L + KAEDI + + S +S + D VI +G S++HV +IADN+ LK+ Sbjct: 7 LEVIVEALDDKKAEDIVVL-DVSGKSSLTDYFVIATGNSSRHVKAIADNVKEELKEA 62 >gnl|CDD|38422 KOG3212, KOG3212, KOG3212, Uncharacterized conserved protein related to IojAP [Function unknown]. Length = 208 Score = 37.3 bits (86), Expect = 0.001 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 +DHL + V++ L++ A+D+ I D+ VI SGRS +H+ +IA+ L+ Sbjct: 66 SDHL--TVEEVVKLLRDENADDVFVIP-VPEEMFYADHTVICSGRSDRHLRAIAEALVYM 122 Query: 73 LKKK 76 K K Sbjct: 123 AKIK 126 >gnl|CDD|145962 pfam03098, An_peroxidase, Animal haem peroxidase. Length = 512 Score = 28.0 bits (63), Expect = 0.55 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 38 IENTSLRSLICDNMVIVS 55 I T+L +ICDN ++ Sbjct: 488 IRKTTLARVICDNTPGIT 505 >gnl|CDD|143907 pfam00135, COesterase, Carboxylesterase. Length = 517 Score = 25.4 bits (56), Expect = 3.9 Identities = 6/16 (37%), Positives = 12/16 (75%) Query: 20 IATVMECLKELKAEDI 35 A ++ECL++ AE++ Sbjct: 256 SAELVECLRKKSAEEL 271 >gnl|CDD|37619 KOG2408, KOG2408, KOG2408, Peroxidase/oxygenase [General function prediction only]. Length = 719 Score = 25.0 bits (54), Expect = 4.7 Identities = 11/46 (23%), Positives = 16/46 (34%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 E + I SL +ICDN ++ S V D + Sbjct: 659 FTPEQLEEIRKVSLARIICDNGTKITKVSRFDVFDFPDAPNDPVPC 704 >gnl|CDD|113842 pfam05087, Rota_VP2, Rotavirus VP2 protein. Rotavirus particles consist of three concentric proteinaceous capsid layers. The innermost capsid (core) is made of VP2. The genomic RNA and the two minor proteins VP1 and VP3 are encapsidated within this layer. The N-terminus of rotavirus VP2 is necessary for the encapsidation of VP1 and VP3. Length = 887 Score = 24.1 bits (52), Expect = 7.8 Identities = 16/56 (28%), Positives = 24/56 (42%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 L +CI M+ ++ L E + TSL LI + VI + H S N + Sbjct: 564 LMACITMNMQLVQTLTTERLQLTSVTSLCMLIGNKTVIPEPSTLFHYYSSNVNFHT 619 >gnl|CDD|146419 pfam03767, Acid_phosphat_B, HAD superfamily, subfamily IIIB (Acid phosphatase). This family proteins includes acid phosphatases and a number of vegetative storage proteins. Length = 230 Score = 24.3 bits (53), Expect = 7.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 51 MVIVSGRSTKHVASIADNLISY 72 + VSGRS A+ +NL Sbjct: 139 IFFVSGRSEDLRAATVENLKKA 160 >gnl|CDD|144479 pfam00898, Orbi_VP2, Orbivirus outer capsid protein VP2. VP2 acts as an anchor for VP1 and VP3. VP2 contains a non-specific DNA and RNA binding domain in the N-terminus. Length = 946 Score = 23.9 bits (52), Expect = 9.5 Identities = 5/20 (25%), Positives = 12/20 (60%) Query: 28 KELKAEDICHIENTSLRSLI 47 ++KA ++C I + R ++ Sbjct: 257 TKIKALELCKILSAIGRKML 276 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.127 0.354 Gapped Lambda K H 0.267 0.0583 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 764,856 Number of extensions: 28639 Number of successful extensions: 83 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 11 Length of query: 77 Length of database: 6,263,737 Length adjustment: 47 Effective length of query: 30 Effective length of database: 5,248,114 Effective search space: 157443420 Effective search space used: 157443420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.7 bits)