RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]} Length = 113 Score = 45.3 bits (107), Expect = 1e-06 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + + + KAE + + N SLI D +I G S K V +IA L +++ Sbjct: 6 LQLAVNAVDDKKAEQVVAL-NMKGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQG 62 >d2id1a1 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]} Length = 120 Score = 42.3 bits (99), Expect = 1e-05 Identities = 14/55 (25%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +E L+++K +DI + +TS + + M++ +G S + V ++A+++ LK+ Sbjct: 10 AIEALEDIKGKDIIEL-DTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLKEAG 63 >d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Score = 29.1 bits (65), Expect = 0.093 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 38 IENTSLRSLICDNM 51 I S++SLIC+N+ Sbjct: 487 INTASIQSLICNNV 500 >d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Score = 28.8 bits (64), Expect = 0.14 Identities = 4/14 (28%), Positives = 9/14 (64%) Query: 38 IENTSLRSLICDNM 51 ++ +L+ L+C N Sbjct: 486 VKTATLKKLVCLNT 499 >g1cxp.1 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 570 Score = 27.8 bits (61), Expect = 0.24 Identities = 6/13 (46%), Positives = 8/13 (61%) Query: 38 IENTSLRSLICDN 50 + SL +ICDN Sbjct: 520 LAQISLPRIICDN 532 >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Score = 23.3 bits (49), Expect = 5.7 Identities = 3/20 (15%), Positives = 7/20 (35%) Query: 12 TADHLDSCIATVMECLKELK 31 + + + +C E K Sbjct: 405 EDAQIRQGLEIISQCFDEAK 424 >d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Length = 159 Score = 23.0 bits (49), Expect = 7.2 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 1/21 (4%) Query: 50 NMVIVSGRSTKHVA-SIADNL 69 N+ I S S +A IAD + Sbjct: 1 NLKIFSLNSNPELAKEIADIV 21 >d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 155 Score = 22.7 bits (48), Expect = 9.4 Identities = 7/20 (35%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 51 MVIVSGRSTKHVA-SIADNL 69 M++VSG ++++A +A L Sbjct: 1 MIVVSGSQSQNLAFKVAKLL 20 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.127 0.354 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 245,452 Number of extensions: 8191 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 17 Length of query: 77 Length of database: 2,407,596 Length adjustment: 44 Effective length of query: 33 Effective length of database: 1,803,476 Effective search space: 59514708 Effective search space used: 59514708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.4 bits)