BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] (77 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] Length = 77 Score = 155 bits (391), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK Sbjct: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 Query: 61 HVASIADNLISYLKKKN 77 HVASIADNLISYLKKKN Sbjct: 61 HVASIADNLISYLKKKN 77 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 28.1 bits (61), Expect = 0.026, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Query: 35 ICHIENTSLRSL---ICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + H S+R + + V+ SGRS+ +ASIA +SY +K+ Sbjct: 475 VLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTRKE 519 >gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Score = 25.4 bits (54), Expect = 0.17, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSG--RSTKHVASIADNLISYLKKK 76 C+ +C+ E + HI N + N++ + RST H+ + A+ LIS+ K++ Sbjct: 269 CVGDENQCIYEWRGAQFSHILNFQ-KDFKDANIIKLEQNYRSTTHILNTANKLISHNKQR 327 >gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus str. psy62] Length = 290 Score = 23.5 bits (49), Expect = 0.79, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Query: 38 IENTSLRSLICD--NMVIVSGRSTKHVASIAD---NLISYLKKK 76 +EN L + ICD M+IV + + ++ D ++I Y K K Sbjct: 117 LENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLK 160 >gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Score = 22.3 bits (46), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 24/46 (52%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + E KA+ EN L+ LI + +S RST + ++NL Sbjct: 101 LQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENL 146 >gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 457 Score = 20.4 bits (41), Expect = 5.2, Method: Composition-based stats. Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 6 EKQALQTADHLDS 18 + ALQ ADHL S Sbjct: 347 DSSALQNADHLTS 359 >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 20.4 bits (41), Expect = 6.1, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 39 ENTSLRSLICDNMVIVSGRSTKH 61 +NTS +++CD M + + S KH Sbjct: 79 KNTSDTTIVCDVMKLRTLISEKH 101 >gi|254780740|ref|YP_003065153.1| peptidase S16 lon domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 221 Score = 20.4 bits (41), Expect = 6.2, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIEN 40 + EKQAL A + T++ +K + A H EN Sbjct: 180 FSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCEN 218 >gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 20.0 bits (40), Expect = 7.7, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 52 VIVSGRSTKHVASIADNLISYLKK 75 +I S R KHV S+ + + Y KK Sbjct: 235 LIPSIREYKHVYSLDEKKLKYAKK 258 >gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Score = 20.0 bits (40), Expect = 7.9, Method: Composition-based stats. Identities = 6/18 (33%), Positives = 12/18 (66%) Query: 33 EDICHIENTSLRSLICDN 50 + +C I N + +L+CD+ Sbjct: 181 DSLCAIGNEGILALMCDS 198 >gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910 Score = 20.0 bits (40), Expect = 8.7, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 41 TSLRSLICDNMVIVSG 56 TSL+SL NMV ++G Sbjct: 331 TSLQSLFSVNMVALNG 346 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.127 0.354 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,222 Number of Sequences: 1233 Number of extensions: 1271 Number of successful extensions: 15 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of query: 77 length of database: 328,796 effective HSP length: 47 effective length of query: 30 effective length of database: 270,845 effective search space: 8125350 effective search space used: 8125350 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)