HHsearch alignment for GI: 254780563 and conserved domain: COG0687

>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism].
Probab=99.77  E-value=4.5e-18  Score=122.82  Aligned_cols=185  Identities=19%  Similarity=0.175  Sum_probs=115.9

Q ss_pred             CCHHHHH---HHHHHHHHHHHHH--CCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHH---HHHHCC
Q ss_conf             9025999---9999999999861--2444588089981899899999999999875986210000135667---652106
Q gi|254780563|r    1 MFKRTIY---TYLLLLCGFTEAF--STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---PITQGS   72 (195)
Q Consensus         1 mmkk~~~---~~l~l~~~~~~~~--~~~~~~~~lvVYs~~~~~~~~~~~~~Fek~tgIkV~~~~~~~~~~~---~~~~~~   72 (195)
T Consensus         1 m~k~~~~~~~~~~~~~~~a~~~~~~~a~a~~~~l~v~~w~gy~~~-~~~~~F~k~tGi~V~~~~~~sne~~~ak~~~g~~   79 (363)
T COG0687           1 MMKKLSRRSFLALAALALAALAGAAAAAAEGKTLNVYNWGGYIDP-ALLKPFEKETGIKVVYDTFDSNEEMLAKLKAGGG   79 (363)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCHHHHHHCCCEEEEECCCCCCCH-HHHHHHHHHHCCEEEEECCCCHHHHHHHHHHCCC
T ss_conf             941466667899999999986000456625785999647875577-8899899998997999538986999999980899


Q ss_pred             CCCEEEECC-HHHHHHHHHHHCCCCCCCCCC---CCCCCCCCC------CCCCCCCCCEEEEEEEHHHHCCCCCCCCHHH
Q ss_conf             665575042-233234331000012342223---472000122------2223443450588873344013445578888
Q gi|254780563|r   73 PVDVIITKD-ETSLALNEDLLHKLPAHLIKK---NSFVLKNEN------KKLMRISFDTQVLAYSTKRIKIADLPKSVFD  142 (195)
Q Consensus        73 ~~d~~~~~d-~~~l~~~~~~l~~~~~~~~~~---~~~~~~~~~------~~~~~~~~~~~~~~~n~~~~~~~~~P~sw~D  142 (195)
T Consensus        80 ~~Dvv~~s~~~~~~~~~~gll~~lD~skl~n~~~l~~~~~~~~~~d~g~~y~vPy~~g~t~i~Yn~~~~~~~~~~~sW~~  159 (363)
T COG0687          80 GYDVVVPSGYFVARLIKEGLLQPLDKSKLPNWKNLDPEFLNPPKFDPGNKYSVPYFWGTTGIAYNTDKVKDAPPPTSWAD  159 (363)
T ss_pred             CCCEEECCHHHHHHHHHCCCCCCCCHHHCCCHHHCCHHHHCCCCCCCCCEECEEEEEEEEEEEEECCCCCCCCCCCCHHH
T ss_conf             98879718889999986675675896666482116987835776788886031678864699998000589999988999


Q ss_pred             HCCHH----HCCE-EEECCCCCCHHHHHHHHHHHH-------CHHHHHHHHHHHHH
Q ss_conf             40866----7685-996289830499999999960-------86999999999860
Q gi|254780563|r  143 LTNAQ----WKKR-LSIAPNNISFHRLLNTMEQTP-------NKTVVQDFIKNITA  186 (195)
Q Consensus       143 L~~p~----~kG~-i~~~~~~~s~~~~~~a~~~~~-------G~~~~~~~l~~l~~  186 (195)
T Consensus       160 l~d~~~~~~~k~~~~~~~d~~~~~~~~al~~lg~~~n~~~~~~~~~a~~~L~~~kp  215 (363)
T COG0687         160 LFDPEKFPGLKGKGVALLDDDREVFGAALALLGKSPNTTDPEDLKKAFDLLDKLKP  215 (363)
T ss_pred             HHCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             83842002232575301366057899999971899788998899999999997278