HHsearch alignment for GI: 254780563 and conserved domain: COG1653

>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism].
Probab=98.71  E-value=2.4e-07  Score=61.65  Aligned_cols=142  Identities=17%  Similarity=0.201  Sum_probs=76.2

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCC-CC-CCEEEECCC---C-HHHHHHHHHHHHHHCC-CCCCCCCHHH---HHHHH---HH
Q ss_conf             2599999999999998612444-58-808998189---9-8999999999998759-8621000013---56676---52
Q gi|254780563|r    3 KRTIYTYLLLLCGFTEAFSTEN-TT-KYLTLYTDQ---N-QSVMLPIIHSFEERTG-VKISPIYTSS---IQRPP---IT   69 (195)
Q Consensus         3 kk~~~~~l~l~~~~~~~~~~~~-~~-~~lvVYs~~---~-~~~~~~~~~~Fek~tg-IkV~~~~~~~---~~~~~---~~   69 (195)
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~i~~f~~~~p~ikV~~~~~~~~~~~~~l~~~~~a   84 (433)
T COG1653           5 SKLLLLLLAAALGLAACGSAAASAAGVTITFWHSWTGGEEADALEELIKEFEKENPGIKVKVVNVPGDDYLQKLLTALAS   84 (433)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHC
T ss_conf             99999999999999999743024557439999833787315899999999997779847999856758899999999857


Q ss_pred             HCCCCCEEEECC-HHHHHHHHHH-HCCCCCCC-----CCCCCC---CCCCCCCCC--CCCCCCEEEEEEEHHHHCCCC--
Q ss_conf             106665575042-2332343310-00012342-----223472---000122222--344345058887334401344--
Q gi|254780563|r   70 QGSPVDVIITKD-ETSLALNEDL-LHKLPAHL-----IKKNSF---VLKNENKKL--MRISFDTQVLAYSTKRIKIAD--  135 (195)
Q Consensus        70 ~~~~~d~~~~~d-~~~l~~~~~~-l~~~~~~~-----~~~~~~---~~~~~~~~~--~~~~~~~~~~~~n~~~~~~~~--  135 (195)
T Consensus        85 g~~p-Dv~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~dG~~y~~P~~~~~~~~~ynkd~~~~aG~~  163 (433)
T COG1653          85 GDAP-DVVQLDPEWLAAFAKAGGLLEDLTDLINPKLDLSDFPPALLDTTTYDGKLYGVPFNSSTPALFYNKDLFKKAGLK  163 (433)
T ss_pred             CCCC-EEEEECCHHHHHHHHHCCCCCCCCCCCCCCHHHHHCCHHHHHHEEECCEEEEEEEECCCCEEEEEHHHHHHCCCC
T ss_conf             9998-199977376899997267656664100123024430477674246898689998432475699878999976999


Q ss_pred             C-CCCHHHHCC
Q ss_conf             5-578888408
Q gi|254780563|r  136 L-PKSVFDLTN  145 (195)
Q Consensus       136 ~-P~sw~DL~~  145 (195)
T Consensus       164 ~pp~tw~e~~~  174 (433)
T COG1653         164 PPPKTWDELLA  174 (433)
T ss_pred             CCCCCHHHHHH
T ss_conf             99999899999