HHsearch alignment for GI: 254780563 and conserved domain: PRK03002

>PRK03002 prsA peptidylprolyl isomerase; Reviewed.
Probab=91.16  E-value=0.48  Score=25.66  Aligned_cols=34  Identities=21%  Similarity=0.245  Sum_probs=18.3

Q ss_pred             CCHHHHHHHHHHHHHH-HHHHCCCCCCCCEEEECC
Q ss_conf             9025999999999999-986124445880899818
Q gi|254780563|r    1 MFKRTIYTYLLLLCGF-TEAFSTENTTKYLTLYTD   34 (195)
Q Consensus         1 mmkk~~~~~l~l~~~~-~~~~~~~~~~~~lvVYs~   34 (195)
T Consensus         1 mkkK~i~~~~~~~svl~LaaC~~~~~~~~VAtv~g   35 (285)
T PRK03002          1 MRGKHIFIITALISILMLSACGQKNSSATVATATD   35 (285)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             96018999999999999998457999977998689