HHsearch alignment for GI: 254780563 and conserved domain: PRK11205

>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional.
Probab=100.00  E-value=2.1e-33  Score=210.23  Aligned_cols=168  Identities=14%  Similarity=0.160  Sum_probs=135.5

Q ss_pred             HHCCCCCCCCEEEECCCCHHHH----HHHHHHHHHHCCCCCCCCCHHHH-H---HHH-HHHCCCCCEEEECCHHHHH--H
Q ss_conf             6124445880899818998999----99999999875986210000135-6---676-5210666557504223323--4
Q gi|254780563|r   19 AFSTENTTKYLTLYTDQNQSVM----LPIIHSFEERTGVKISPIYTSSI-Q---RPP-ITQGSPVDVIITKDETSLA--L   87 (195)
Q Consensus        19 ~~~~~~~~~~lvVYs~~~~~~~----~~~~~~Fek~tgIkV~~~~~~~~-~---~~~-~~~~~~~d~~~~~d~~~l~--~   87 (195)
T Consensus        11 ~a~~~~~~~~l~vyt~dsf~~d~g~~~~l~~~Fek~tGikV~~v~~~dg~~ll~Rl~~Eg~np~ADVv~gvD~~~l~~A~   90 (326)
T PRK11205         11 CAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFEAECGCELKFVALEDGVSLLNRLRLEGKNSKADVVLGLDNNLLAAAK   90 (326)
T ss_pred             HCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHH
T ss_conf             63620029879999665444466864799999989879689999679679999999973899976589981767899999


Q ss_pred             HHHHHCCCCCCCCC-CCCCCCCCCCCCCCCCCCCEEEEEEEHHHHCCCCCCCCHHHHCCHHHCCEEEECCC--CCCHHHH
Q ss_conf             33100001234222-34720001222223443450588873344013445578888408667685996289--8304999
Q gi|254780563|r   88 NEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN--NISFHRL  164 (195)
Q Consensus        88 ~~~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~P~sw~DL~~p~~kG~i~~~~~--~~s~~~~  164 (195)
T Consensus        91 ~~gl~~p~~s~~~~~~ip~~~~d~--~~vp~d~g~~a~vYn~~~~~--~~P~S~~DL~~p~~kgki~i~dP~tSs~g~a~  166 (326)
T PRK11205         91 KTGLFAPSGVDTSAVTVPGGWNDD--TFVPYDYGYFAFVYDKEKLK--NPPKSLKELVESDQNWKVIYQDPRTSTPGLGL  166 (326)
T ss_pred             HCCCCCCCCCCHHHCCCCCCCCCC--CEECCCCCEEEEEEEHHHCC--CCCCCHHHHHCCHHCCCEEECCCCCCCCHHHH
T ss_conf             869965256861102486002698--52113476589998422237--88769898727330388663388878527999


Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHCCCCC
Q ss_conf             999999608699999999986088705
Q gi|254780563|r  165 LNTMEQTPNKTVVQDFIKNITANEILT  191 (195)
Q Consensus       165 ~~a~~~~~G~~~~~~~l~~l~~N~~~~  191 (195)
T Consensus       167 l~~~i~~~Ge~~-~e~W~~L~~N~~~~  192 (326)
T PRK11205        167 LLWMKKVYGDDA-PQAWQKLAKKTVTV  192 (326)
T ss_pred             HHHHHHHHCCCH-HHHHHHHHHCCCCC
T ss_conf             999999716328-99999998638444