HHsearch results for GI: 254780563 and protein with PDBid: 3c9h_A

>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str}
Probab=99.81  E-value=2.6e-19  Score=128.62  Aligned_cols=188  Identities=11%  Similarity=0.109  Sum_probs=129.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHC--------CCCCCCCEEEECCCCHHHHHHHHHHHHHHC-CCCCCCCCHHHHHH---HH--
Q ss_conf             02599999999999998612--------444588089981899899999999999875-98621000013566---76--
Q gi|254780563|r    2 FKRTIYTYLLLLCGFTEAFS--------TENTTKYLTLYTDQNQSVMLPIIHSFEERT-GVKISPIYTSSIQR---PP--   67 (195)
Q Consensus         2 mkk~~~~~l~l~~~~~~~~~--------~~~~~~~lvVYs~~~~~~~~~~~~~Fek~t-gIkV~~~~~~~~~~---~~--   67 (195)
                      ||+++++.|++.++..++++        +.+..++|+|||+.++...++++++||++| ||+|+++..+..+.   +.  
T Consensus         1 ~~~~l~l~l~~~~a~~ala~~~~~~~~~~~~~~~~l~v~s~~~~~~~~~li~~Fe~~~PgI~V~~~~~~~~~~~~kl~~~   80 (355)
T 3c9h_A            1 MRICLFLCLCLCMASPALAQVAVFPALSGKTDAQTLVVYSSLDEPLATPMIEGFQKANPDIAVHYEDMLTGEIYDRIVKE   80 (355)
T ss_dssp             ---------------CEEEEEEEECCTTC----CEEEEEECSCHHHHHHHHHHHHHHCTTCEEEEEECCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             90799999999999999988864234356777997999979887899999999998788938999968858999999987


Q ss_pred             -HHHCCCCCEEEECCHHHHH--HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHCCCCCCCCHHHHC
Q ss_conf             -5210666557504223323--4331000012342223472000122222344345058887334401344557888840
Q gi|254780563|r   68 -ITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT  144 (195)
Q Consensus        68 -~~~~~~~d~~~~~d~~~l~--~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~P~sw~DL~  144 (195)
                       ...+.+.|+++..+...+.  ...+++..++. ......+...+...++++....+.++.||++.+.....|++|.++.
T Consensus        81 ~~ag~~~~Dv~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~yn~~~~~~~~~~~~~~~~~  159 (355)
T 3c9h_A           81 TDAGKKTADFAFSSAMDLQVKLSNDGYAQRSDL-AMSARWPAWANWRNTAYALTFEPAVFVYHKPSFTTEKPPATRAEFV  159 (355)
T ss_dssp             HHTTCCBCSEEEESCHHHHHHHHHTTCEECCCC-TTTTTSCGGGEETTTEEECBCEEEEEEEEGGGCSSSCCCCSHHHHH
T ss_pred             HHCCCCCCCEEEECCHHHHHHHHHCCCCCCCCC-HHHHCCCHHCCCCCCEEECCCEEEEEEEECCCCCCCCCCCCHHHHH
T ss_conf             514898642676165789999996687445771-2220360220566855500120689999433333446888767765


Q ss_pred             ------CHHHCCEEEECCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHCCCC
Q ss_conf             ------8667685996289830499999999960869999999998608870
Q gi|254780563|r  145 ------NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL  190 (195)
Q Consensus       145 ------~p~~kG~i~~~~~~~s~~~~~~a~~~~~G~~~~~~~l~~l~~N~~~  190 (195)
                            ..+.+|...+.+...++...........+.+.++++++++.+|+..
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~  211 (355)
T 3c9h_A          160 DYLERHAKEVHGRIATYDIERSGVGFLFMSRDQEQFGDIWSVIKAMGAAGVK  211 (355)
T ss_dssp             HHHHHTHHHHTTCEEEECTTC-CHHHHHHHHHHHHCTTHHHHHHHHHHTTCE
T ss_pred             HHHHHHHHHHCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             6887643332284311464210246666655321258999999998750576