BLAST/PSIBLAST alignment of GI: 254780563 and GI: 312114161 at iteration 1
>gi|312114161|ref|YP_004011757.1| extracellular solute-binding protein family 1 [Rhodomicrobium vannielii ATCC 17100] Length = 331
>gi|311219290|gb|ADP70658.1| extracellular solute-binding protein family 1 [Rhodomicrobium vannielii ATCC 17100] Length = 331
 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 82/163 (50%), Gaps = 4/163 (2%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           LT+Y+ + +S   PI   FEE+TG+KI   Y S+ +   +   +G  SP DV + +D  +
Sbjct: 26  LTVYSGRGESFAGPIFKIFEEQTGIKIKARYGSTAELSALLKEEGAKSPADVFLAQDAGA 85

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L  N  L    P  L +      ++ + K +  S   + LAYS +R+K   LPKS FDLT
Sbjct: 86  LIENRPLFADAPKALSETVLPQFRSNDSKWLATSGRARTLAYSKERVKGDQLPKSAFDLT 145

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +WK ++  +P N SF   L  +     +   + F+K +  N
Sbjct: 146 KPEWKGKVGYSPKNASFQAFLTALRVQEGEEKAKAFVKGLVDN 188