BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780563|ref|YP_003064976.1| extracellular solute-binding
protein [Candidatus Liberibacter asiaticus str. psy62]
         (195 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780563|ref|YP_003064976.1| extracellular solute-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040240|gb|ACT57036.1| extracellular solute-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 195

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/195 (100%), Positives = 195/195 (100%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT
Sbjct: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60

Query: 61  SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
           SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD
Sbjct: 61  SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
           TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF
Sbjct: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180

Query: 181 IKNITANEILTKYKR 195
           IKNITANEILTKYKR
Sbjct: 181 IKNITANEILTKYKR 195


>gi|238059298|ref|ZP_04604007.1| extracellular solute-binding protein [Micromonospora sp. ATCC
           39149]
 gi|237881109|gb|EEP69937.1| extracellular solute-binding protein [Micromonospora sp. ATCC
           39149]
          Length = 347

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 6/184 (3%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--I 68
           L  CG  E    +   K LT+Y+ +++S++ P++  FE+ +GV +   Y ++ Q     +
Sbjct: 21  LTACGGDEGDPGKPGDKRLTIYSGRSESLVKPVLEKFEKSSGVTVDVRYGTTAQMAAQLL 80

Query: 69  TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +G  SP DV   +D  +L       L   LP  L+ +     +    + + +S  ++VL
Sbjct: 81  EEGGRSPADVFFAQDAGALGAVTKAGLFAVLPQDLLDRVPAAYRAAGGQWVGVSGRSRVL 140

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
           AY+  ++    LP SVF+LT+ +WK RL +AP N SF   +  +         ++F+  +
Sbjct: 141 AYNVDQVTKEQLPTSVFELTDPKWKGRLGVAPTNGSFQAFVTALRVQHGDAKAREFLTGL 200

Query: 185 TANE 188
            ANE
Sbjct: 201 KANE 204


>gi|159037068|ref|YP_001536321.1| extracellular solute-binding protein [Salinispora arenicola
           CNS-205]
 gi|157915903|gb|ABV97330.1| extracellular solute-binding protein family 1 [Salinispora
           arenicola CNS-205]
          Length = 355

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 102/204 (50%), Gaps = 16/204 (7%)

Query: 1   MFKRTIYTYL---LLLCGFTEAFSTENTT-------KYLTLYTDQNQSVMLPIIHSFEER 50
           +F+R+  T++   L+  G     S ++ T       K +T+Y+ +N+ ++ P++  F E+
Sbjct: 8   LFRRSAATFVATGLVAVGLVACGSGQDDTDPGEPNDKIITVYSGRNEKLVKPLLERFTEQ 67

Query: 51  TGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNS 104
           TG++I P Y ++ Q     + +G  SP D+   +D  +L     + +   LP     K +
Sbjct: 68  TGIEIRPRYATTAQLAAQLVEEGDRSPADIFFAQDAGALGTVAKQGMFATLPETSTGKVT 127

Query: 105 FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRL 164
              +  + + + +S  ++VL Y+  ++    LP SVFDLT   WK ++++AP N SF   
Sbjct: 128 ETYRARSGQWVGVSARSRVLVYNADQVPADQLPTSVFDLTGPDWKGKVALAPTNASFQAF 187

Query: 165 LNTMEQTPNKTVVQDFIKNITANE 188
           +  +         +DF+  + ANE
Sbjct: 188 VTAIRVQHGDQRAKDFLSGLKANE 211


>gi|312114161|ref|YP_004011757.1| extracellular solute-binding protein family 1 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219290|gb|ADP70658.1| extracellular solute-binding protein family 1 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 331

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 82/163 (50%), Gaps = 4/163 (2%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           LT+Y+ + +S   PI   FEE+TG+KI   Y S+ +   +   +G  SP DV + +D  +
Sbjct: 26  LTVYSGRGESFAGPIFKIFEEQTGIKIKARYGSTAELSALLKEEGAKSPADVFLAQDAGA 85

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L  N  L    P  L +      ++ + K +  S   + LAYS +R+K   LPKS FDLT
Sbjct: 86  LIENRPLFADAPKALSETVLPQFRSNDSKWLATSGRARTLAYSKERVKGDQLPKSAFDLT 145

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +WK ++  +P N SF   L  +     +   + F+K +  N
Sbjct: 146 KPEWKGKVGYSPKNASFQAFLTALRVQEGEEKAKAFVKGLVDN 188


>gi|330466473|ref|YP_004404216.1| extracellular solute-binding protein [Verrucosispora maris
           AB-18-032]
 gi|328809444|gb|AEB43616.1| extracellular solute-binding protein [Verrucosispora maris
           AB-18-032]
          Length = 352

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 94/191 (49%), Gaps = 10/191 (5%)

Query: 8   TYLLLLCGFTE----AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           T  L  CG  E      S ++  K +T+Y+ +N+ ++ P++  F E+TG+ ++  Y ++ 
Sbjct: 18  TVGLAACGSGEEDKATGSDQSADKQITVYSGRNEQLIKPLLDKFTEQTGIAVNARYANTA 77

Query: 64  QRPP--ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           Q     + +G  SP DV + +D  +L     + +   LP     K     +  N + + +
Sbjct: 78  QLAAQLVEEGDKSPADVFLAQDAGALGTVAKQGMFSTLPEATTAKVPATYRAGNGQWVGV 137

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           S   +VLAY+   +    LP SVFDLT   WK ++ +AP N SF   +  +    +    
Sbjct: 138 SARARVLAYNPDLVPADQLPASVFDLTGPAWKGKVGVAPTNASFQAFITAIRVQHDDAKA 197

Query: 178 QDFIKNITANE 188
           ++F++ + AN+
Sbjct: 198 EEFLRGLKAND 208


>gi|262199751|ref|YP_003270960.1| extracellular solute-binding protein family 1 [Haliangium ochraceum
           DSM 14365]
 gi|262083098|gb|ACY19067.1| extracellular solute-binding protein family 1 [Haliangium ochraceum
           DSM 14365]
          Length = 356

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           LT+Y+ +++ ++ P + +FE+ +GV +   Y  T+ +    + +G  SP DV I +D +S
Sbjct: 50  LTVYSGRSEKLVAPALQAFEQLSGVDLEIKYGDTAELAAALLDEGENSPADVFIAQDASS 109

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           LA   ++DL   LP  +  + +   + ++   + ++   +VLAY+T ++K  DLPKS  +
Sbjct: 110 LAFLASKDLFAPLPDDIGGRVAETFRADDASWVGLTGRARVLAYNTDKLKPEDLPKSAAE 169

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           L +  WK R+  AP N SF   +  M Q       Q +++ + ANE
Sbjct: 170 LGDPVWKGRVGWAPENASFQSAVAAMVQLEGAEATQTWLEAVKANE 215


>gi|328951243|ref|YP_004368578.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451567|gb|AEB12468.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 333

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 88/165 (53%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           L +Y+ +++S++ PII  FE  TG+ +   Y  T+ +    + +G  SP D+   +D  +
Sbjct: 26  LVIYSGRSKSLVEPIIQQFERETGINVRVKYGKTAELAVLLLEEGIRSPADLFWAQDAGA 85

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L      DL  KLP  ++ +     +NEN   + I+   + LAYS +R+K  +LPKS+FD
Sbjct: 86  LGAVAKADLFVKLPESVVARVPEQFRNENGLWVAITGRARTLAYSPERVKPEELPKSIFD 145

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           LT+ +W  R+  AP N SF   +  M     +   + ++ ++ AN
Sbjct: 146 LTDPKWAGRVGWAPTNASFQAFVTAMRVLYGEETTKQWLLDMKAN 190


>gi|91065105|gb|ABE03937.1| permease [Theonella swinhoei bacterial symbiont clone pSW1H8]
          Length = 332

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 90/167 (53%), Gaps = 6/167 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           LT+Y+ +N++ + P+I +FE+ TG+ +   Y  T+++    + +G  SP DV + +D  +
Sbjct: 27  LTVYSGRNEAFVGPVIEAFEQTTGIDVEVRYGGTAALAAVILEEGNLSPADVFLAQDAGA 86

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E L  +LP  ++ +     ++     + ++   +VL YST+ +   +LP SVF+
Sbjct: 87  LGALSREGLFQRLPDSILSQVDARFRSPEGLWVGVTGRARVLVYSTENVAEEELPMSVFE 146

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           LT  +W+ R+  AP N SF   +  M     +   +++++ + AN +
Sbjct: 147 LTGPEWQGRVGWAPTNGSFQAFVTAMRVVVGEERTREWLQGMIANGV 193


>gi|297623762|ref|YP_003705196.1| family 1 extracellular solute-binding protein [Truepera
           radiovictrix DSM 17093]
 gi|297164942|gb|ADI14653.1| extracellular solute-binding protein family 1 [Truepera
           radiovictrix DSM 17093]
          Length = 329

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 87/167 (52%), Gaps = 6/167 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           LT+Y+ +++  + P++  FE  TG+++   Y  T+ +    + +G  SP DV   +D  +
Sbjct: 24  LTVYSGRSEDFIAPLVERFEAETGLQVDVRYGNTAELAATLLEEGANSPADVFFPQDGGA 83

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E L  +LP  L+++     ++     + ++   +VLAY+T  +   +LP SVF+
Sbjct: 84  LGAVAREGLFAELPGELLERVDARFRSPEGLWVGVTGRARVLAYNTDSVSEDELPASVFE 143

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           LT  QW+ R+  AP N SF   +  M     +   +++++ + AN +
Sbjct: 144 LTEPQWQGRVGWAPTNASFQAFVTAMRLLEGEARTREWLEGMLANGV 190


>gi|260771842|ref|ZP_05880760.1| ferric iron ABC transporter iron-binding protein [Vibrio
           metschnikovii CIP 69.14]
 gi|260613134|gb|EEX38335.1| ferric iron ABC transporter iron-binding protein [Vibrio
           metschnikovii CIP 69.14]
          Length = 332

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 88/166 (53%), Gaps = 6/166 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPVDVIITKDETS 84
           +TLY+ + ++++ PII  FE+++G+K++  Y  + Q   + Q     SP DV   +D  +
Sbjct: 26  ITLYSGRGETLVKPIIEQFEKQSGIKVNVRYGDTAQLAVLLQEEGARSPADVYWGQDAGA 85

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +    N  LL  LP  + K+   +  ++  + +  S  ++V+AYST+R    D+P SVFD
Sbjct: 86  MGALANAGLLATLPEAVYKQLPEIYTSKTGQWVAASGRSRVIAYSTERASAEDIPASVFD 145

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           LT+ +++ R  +AP N  F   +  M           ++K + AN+
Sbjct: 146 LTSEKYQGRFGLAPTNGGFQSFVTAMRVQHGDEKTLAWLKAMKANQ 191


>gi|239917160|ref|YP_002956718.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
 gi|281414370|ref|ZP_06246112.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
 gi|239838367|gb|ACS30164.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
          Length = 363

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 89/171 (52%), Gaps = 6/171 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS----SIQRPPITQGSPVDVIIT 79
            + K +TLY+ +++ ++ PI+  F + TG+++   Y      + Q     +GSP DV ++
Sbjct: 51  ESDKKVTLYSGRSEDLVQPILDEFTDETGIEVEVRYDKTPAMAAQLVEEGEGSPADVFLS 110

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           +D  +L     E L   L    + +     +++    + ++   +VLAY+ +++  ADLP
Sbjct: 111 QDAGALGAVAKEGLFTPLAQETLDRVPETYRDDEGDWVGLTGRVRVLAYNEEKVPEADLP 170

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            SV +LT+ +WK R+ +AP N SF   +  +     +   + ++++  AN+
Sbjct: 171 TSVDELTDPKWKGRVGVAPTNASFQTFVTALRLQKGEDEARTWLEDFAAND 221


>gi|108759415|ref|YP_629036.1| iron ABC transporter periplasmic iron-binding protein [Myxococcus
           xanthus DK 1622]
 gi|108463295|gb|ABF88480.1| iron ABC transporter, periplasmic iron-binding protein [Myxococcus
           xanthus DK 1622]
          Length = 327

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 81/165 (49%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQGS--PVDVIITKDETS 84
           LT+Y+ +N+ ++ P++  F E+TGV++   Y  + Q     + +G+  P DV   +D  +
Sbjct: 23  LTIYSGRNEKLVGPLLKKFTEKTGVEVKVRYGETPQLAATLLEEGAKTPADVFFAQDAGA 82

Query: 85  LALNEDL--LHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L        L  LP   + K     ++     +  S   +V+AY+TK++K   LPKS+  
Sbjct: 83  LGALAKAGQLQVLPKETLDKVDARFRSPQGVWVGTSGRARVVAYNTKKVKADTLPKSILG 142

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            T+A+WK RL  AP N SF   +  +           ++K + AN
Sbjct: 143 FTDAKWKGRLGWAPTNASFQSFVTALRLLKGDEAATQWLKGVQAN 187


>gi|312144399|ref|YP_003995845.1| extracellular solute-binding protein family 1 [Halanaerobium sp.
           'sapolanicus']
 gi|311905050|gb|ADQ15491.1| extracellular solute-binding protein family 1 [Halanaerobium sp.
           'sapolanicus']
          Length = 337

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 85/166 (51%), Gaps = 6/166 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGSPVDVIITKDETS 84
           +T+Y+ ++++++ P+   F E TG++I+  Y  + +         Q SP D+   +D  +
Sbjct: 32  ITIYSGRSENLIGPVFEMFTEETGIEINVNYGGTAELAATILEEGQNSPADIFFAQDAGA 91

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    + D L +LP   + K    L+++    +  S   +V+AY+T  +  A+LP +++ 
Sbjct: 92  LGALADNDRLVELPEEYLNKVDSRLRSQEGLWLGTSGRARVVAYNTDYVDEAELPDTIWG 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
             + +W+ R+  AP N SF   +  +     +   +++++ I AN+
Sbjct: 152 FLDEEWQGRIGWAPTNGSFQAFVTALRVLEGEERAEEWLRGIVANQ 197


>gi|313680521|ref|YP_004058260.1| extracellular solute-binding protein family 1 [Oceanithermus
           profundus DSM 14977]
 gi|313153236|gb|ADR37087.1| extracellular solute-binding protein family 1 [Oceanithermus
           profundus DSM 14977]
          Length = 330

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 87/165 (52%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           L +Y+ +++S++ P I  F++ TG+++   Y  T+ +    + +G  SP D+ + +D  +
Sbjct: 24  LVVYSGRSKSLVEPAIERFQQATGLRVRVKYGKTAPLALLLLEEGDRSPADLFLAQDAGA 83

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L+L         LP  L+++     ++ + + + ++   + LAY+ +R    +LP SVFD
Sbjct: 84  LSLLAEAGRFAPLPEALLERVPARFRDPDGRWIGVTGRARTLAYAPERAAAGELPGSVFD 143

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           LT  +++ R+ IAP N SF   +  M           +++++ AN
Sbjct: 144 LTAPRFQGRVGIAPTNASFQTFVTAMRAVHGDARTLAWLRDLKAN 188


>gi|209524597|ref|ZP_03273145.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
 gi|209495055|gb|EDZ95362.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
          Length = 334

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 96/200 (48%), Gaps = 12/200 (6%)

Query: 1   MFKRTIYTY----LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS 56
           MFKR  +      L L+ G  +   ++N T  LT+Y+ + ++++ P+I   E+  G+ I 
Sbjct: 1   MFKRRHFLAGMLTLALVLGIAQVSQSQNQT--LTIYSGRQEALIGPLIKRAEQELGLNIR 58

Query: 57  PIY--TSSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNE 110
             Y  T+ +    I +G  SP D+   +D  +L           +PA +I +     ++ 
Sbjct: 59  VRYGDTAELAIAIIEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQIISRVDSRFRSP 118

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQ 170
           N   + I+   +VLAY+T+++   +LP S+ +LT  +W+ R+  AP N SF   +  M  
Sbjct: 119 NNHWVGITGRARVLAYNTRQVNRNELPNSISELTQPKWRGRVGWAPTNGSFQSFVTAMRL 178

Query: 171 TPNKTVVQDFIKNITANEIL 190
                    +++ +  N ++
Sbjct: 179 VEGDAKTMQWLQAMRNNGVV 198


>gi|291565974|dbj|BAI88246.1| putative iron ABC transporter substrate binding protein
           [Arthrospira platensis NIES-39]
          Length = 334

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 88/178 (49%), Gaps = 12/178 (6%)

Query: 1   MFKRTIYTY----LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS 56
           MFKR  +      L L+ G  +   ++N T  LT+Y+ + ++++ P+I   E++ G+ I 
Sbjct: 1   MFKRRHFLAGMLTLALVLGLAQVSQSQNQT--LTIYSGRGEALIGPLIKQAEQQLGINIR 58

Query: 57  PIY--TSSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNE 110
             Y  T+ +    + +G  SP D+   +D  +L           +PA +I K     ++ 
Sbjct: 59  VRYGDTAELAIAILEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQMISKVDSRFRSP 118

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
           N   + I+   +VLAY+T ++    LP S+ +LT  +W+ R+  AP N SF   +  M
Sbjct: 119 NNHWVGITGRARVLAYNTNQVNRNQLPNSISELTQPKWRGRVGWAPTNGSFQSFVTAM 176


>gi|310830323|ref|YP_003965423.1| ferric iron ABC transporter iron-binding protein
           [Ketogulonicigenium vulgare Y25]
 gi|308753229|gb|ADO44372.1| ferric iron ABC transporter iron-binding protein
           [Ketogulonicigenium vulgare Y25]
          Length = 331

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 88/178 (49%), Gaps = 5/178 (2%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQ 70
           GF  + +T  + + LT+Y+ + ++++ P++  FE  TG+     Y S+ +   +     +
Sbjct: 14  GFA-SVATMASAQSLTIYSGRGEALIGPLVAQFEAETGIDAEVRYGSTAEMAALLMEEGE 72

Query: 71  GSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
            +P D+   +D  +L         L A + +    V ++ + K +  S  T+VL YST R
Sbjct: 73  NTPADLFWAQDAGALGALAPHFSDLAAGVNETVLPVFRDPSNKWVATSGRTRVLVYSTDR 132

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           ++   LP ++ DLT+  ++ R++ AP N SF   +     T      + +++ + ANE
Sbjct: 133 VEEGALPAAITDLTDEAYRGRVAWAPTNGSFQAFVTAFRLTHGDDAAKAWLEGMIANE 190


>gi|284051124|ref|ZP_06381334.1| ferric iron-binding periplasmic protein of ABC transporter
           [Arthrospira platensis str. Paraca]
          Length = 334

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 88/178 (49%), Gaps = 12/178 (6%)

Query: 1   MFKRTIYTY----LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS 56
           MFKR  +      L L+ G  +   ++N T  LT+Y+ + ++++ P+I   E++ G+ I 
Sbjct: 1   MFKRRHFLAGMLTLALVLGIAQVSQSQNQT--LTIYSGRGEALIGPLIKQAEQQLGINIR 58

Query: 57  PIY--TSSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNE 110
             Y  T+ +    + +G  SP D+   +D  +L           +PA +I K     ++ 
Sbjct: 59  VRYGDTAELAIAILEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQMISKVDSRFRSP 118

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
           N   + I+   +VLAY+T ++    LP S+ +LT  +W+ R+  AP N SF   +  M
Sbjct: 119 NNHWVGITGRARVLAYNTNQVNRNQLPNSISELTQPKWRGRVGWAPTNGSFQSFVTAM 176


>gi|269929109|ref|YP_003321430.1| extracellular solute-binding protein family 1 [Sphaerobacter
           thermophilus DSM 20745]
 gi|269788466|gb|ACZ40608.1| extracellular solute-binding protein family 1 [Sphaerobacter
           thermophilus DSM 20745]
          Length = 394

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 83/175 (47%), Gaps = 6/175 (3%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGSPV 74
           A +T      LT+Y+ +++ ++  I+  F   +GV++   Y  + +         Q SP 
Sbjct: 79  APATGTVGGSLTVYSGRSEQLIQAIVDQFAAASGVEVKVRYGDTAEMAAAILEEGQSSPA 138

Query: 75  DVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           D+   +D  +L     E LL +LPA ++       ++ +   + IS   + + Y+T+R+ 
Sbjct: 139 DIFFAQDAGALGAVAREGLLAELPADVLDLVEARFRSPDGLWVGISGRARAVVYNTERLS 198

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +D+P S+ D T+  WK RL  AP N SF   +  +       V + +++ I  N
Sbjct: 199 ESDIPPSILDFTDPVWKDRLGWAPTNASFQAAVTAIRVLRGDDVARAWLEGIRDN 253


>gi|108804016|ref|YP_643953.1| extracellular solute-binding protein [Rubrobacter xylanophilus DSM
           9941]
 gi|108765259|gb|ABG04141.1| extracellular solute-binding protein, family 1 [Rubrobacter
           xylanophilus DSM 9941]
          Length = 372

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 84/166 (50%), Gaps = 6/166 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           L +Y+ + + ++ P++  FEER+G+ +   Y  T+ +    + +G  SP D+   +D  +
Sbjct: 67  LIVYSGRTEDLVGPLMEQFEERSGIDVRVRYGDTAELAATILEEGENSPADLFFAQDPGA 126

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E  L  LP  ++ +     ++     +  S   +V+AY+T+ +  ++LP S++ 
Sbjct: 127 LGALAEEGRLRPLPQGILDRVGERFRSPEGLWVGTSGRARVVAYNTEELDPSELPDSIYG 186

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            T+ +W+ R+  AP N SF   +  +     +   + +++ I AN+
Sbjct: 187 FTDPEWEGRIGWAPTNGSFQAFVTALRVLEGEERARAWLEGIQAND 232


>gi|17228877|ref|NP_485425.1| ferric iron-binding periplasmic protein of ABC transporter [Nostoc
           sp. PCC 7120]
 gi|17130729|dbj|BAB73339.1| ferric iron-binding periplasmic protein of ABC transporter [Nostoc
           sp. PCC 7120]
          Length = 336

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 87/182 (47%), Gaps = 6/182 (3%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--IT 69
           ++ G     +   T K LT+Y+ +++ +M P+I   ++  G+ I   Y  S +     I 
Sbjct: 16  IVLGLGLGIAVAATPKTLTVYSGRDEEIMRPLIERAKKDLGLNIEVRYGDSTELAIALIE 75

Query: 70  QG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +G  S  DV   +D  SL     E    KLP+ L+ K     ++   + + IS   +V+ 
Sbjct: 76  EGKNSRADVFYAQDAGSLGAIGREGKAVKLPSQLLNKVDSRFRSPAGEWVGISGRARVID 135

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           Y+TK +K  +LPKSV  L++ +W+ ++  AP N SF   +  M           ++K + 
Sbjct: 136 YNTKLVKANELPKSVMQLSDRKWRGKVGWAPTNGSFLSFVTAMRLMEGDQKTLAWLKAMK 195

Query: 186 AN 187
           AN
Sbjct: 196 AN 197


>gi|251790119|ref|YP_003004840.1| extracellular solute-binding protein family 1 [Dickeya zeae
           Ech1591]
 gi|247538740|gb|ACT07361.1| extracellular solute-binding protein family 1 [Dickeya zeae
           Ech1591]
          Length = 338

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 95/189 (50%), Gaps = 10/189 (5%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           L+ GF+  F  +     + +Y  Q+++++   +  F + TG+K++      S +    + 
Sbjct: 18  LMMGFS--FGAQAEESGIVIYNAQHENLVKSWVDGFTQDTGIKVTLRNGGDSELGNQLVQ 75

Query: 70  QG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +G  SP DV +T++  S+ L  N +L   L A  + +     +  + + + I+  + V  
Sbjct: 76  EGNASPADVFLTENSPSMVLVDNANLFAPLDAGTLAQVESQYRPSHGRWVGIAARSTVFV 135

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           Y+ +++  A LPKS+ DL N +WK R + +P+   F  +++ M +   +    +++K + 
Sbjct: 136 YNPEKLTEAQLPKSLMDLANPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMK 195

Query: 186 ANEILTKYK 194
           AN   T YK
Sbjct: 196 AN--FTAYK 202


>gi|159898246|ref|YP_001544493.1| extracellular solute-binding protein [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159891285|gb|ABX04365.1| extracellular solute-binding protein family 1 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 379

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 81/165 (49%), Gaps = 4/165 (2%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           L +Y+ +++S++ P++  F + TG+ +   Y  T+ +    + +G  SP DV   +D  +
Sbjct: 76  LVVYSGRSESLVAPLLELFTQETGIAVEVRYGDTAEMAAQILEEGDNSPADVFFGQDAGA 135

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L    D   +L   L+        +     +  S   +VL Y+T  +   DLP S+ DLT
Sbjct: 136 LGALSDRFVQLDRSLLNLVDPRFVSSEGTWVGASGRARVLVYNTDVLTSTDLPASILDLT 195

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
             +WK R++ AP N S    +  +  +  + + + +++ + AN++
Sbjct: 196 KPEWKGRVAWAPTNGSLQAFVTALRVSQGEDMAKQWLEGMIANDV 240


>gi|311742443|ref|ZP_07716252.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Aeromicrobium marinum DSM 15272]
 gi|311314071|gb|EFQ83979.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Aeromicrobium marinum DSM 15272]
          Length = 341

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 78/167 (46%), Gaps = 6/167 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           L +Y  +++ ++ P+I  F E TG+++   Y  + +     I +G  +P DV +++D  +
Sbjct: 38  LVVYVGRDEELVSPLIEQFTEETGIQVEARYAGTTEHAATLIDEGDRTPADVFLSQDAGA 97

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +E LL +LPA +         + +   + I+   +V+AY  + +   ++P +V  
Sbjct: 98  LGALADEGLLRELPADITGAVLPEFTSTDGSWVGITGRARVIAYDGEELSADEVPGTVAT 157

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
               +W  R+   P N SF   +            + +++ + +N++
Sbjct: 158 FAEPEWSGRVGFPPGNASFQAFVTAYRVAEGDDAARAWLEGMESNDL 204


>gi|317121340|ref|YP_004101343.1| extracellular solute-binding protein family 1 [Thermaerobacter
           marianensis DSM 12885]
 gi|315591320|gb|ADU50616.1| extracellular solute-binding protein family 1 [Thermaerobacter
           marianensis DSM 12885]
          Length = 380

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 92/191 (48%), Gaps = 11/191 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +  ++L  CG        +  + L +Y+ + QS++ P++  F   TG+ I   Y S+ +
Sbjct: 53  ALAGFVLSGCGVL----GRSGRQELVVYSSRTQSLVHPLLEQFARETGIDIKVRYASTAE 108

Query: 65  --RPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  S  DV+   D           LL +LP  +++K     ++ + + + +S
Sbjct: 109 LVNTLLEEGERSAADVLYLADAGGWGPLRQAGLLAELPQDVLEKVDPRFRSPDGQWVGVS 168

Query: 119 FDTQVLAYSTKRIKIA-DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
             ++V+ Y+  +I    DLP SV DLT+ +WK R+  AP +  +  L+  +  T  +   
Sbjct: 169 GRSKVIVYNKNKIDPGRDLPDSVMDLTDPKWKGRIGWAPTHGEWQILVTAIRLTKGEDAA 228

Query: 178 QDFIKNITANE 188
           + +++ + AN+
Sbjct: 229 RQWLEGMKAND 239


>gi|324997494|ref|ZP_08118606.1| ABC-type Fe3+ transport system, periplasmic component
           [Pseudonocardia sp. P1]
          Length = 999

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 84/168 (50%), Gaps = 6/168 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVDVIITKDE 82
           + LTLY+ +++ ++ P+I  F++++G+ +   Y S+ +     Q    G+P  V +++D 
Sbjct: 44  RTLTLYSGRDEELVAPLIQQFQQQSGITVDTRYGSTTELAAQIQEEGDGTPAQVYLSQDA 103

Query: 83  TSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L +         LPA +         + +   + ++   +V+AY ++ +  A+ P  V
Sbjct: 104 GALGVLAGAGRFAPLPADVAGAVPAGFTSTDGTWVGLTGRARVVAYDSQDVPEAEAPGDV 163

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            +LT+ +W+ R+  AP N SF   +  M  T  +   + ++  + ANE
Sbjct: 164 RELTDPKWRGRVGYAPTNASFQAFVTAMRVTDGEEATRQWLTALAANE 211


>gi|307130565|ref|YP_003882581.1| Ferric iron ABC transporter iron-binding protein [Dickeya dadantii
           3937]
 gi|306528094|gb|ADM98024.1| Ferric iron ABC transporter, iron-binding protein [Dickeya dadantii
           3937]
          Length = 338

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 96/189 (50%), Gaps = 10/189 (5%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           L+ GF+  F  +   + L +Y  Q+++++   +  F + TG+K++      S +    + 
Sbjct: 18  LMMGFS--FGAQAEDEGLVIYNAQHENLVKSWVDGFTQDTGIKVTLRNGGDSELGNQLVQ 75

Query: 70  QG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +G  SP DV +T++  S+ L  N +L   L A  +++ +   +  + + + I+  + V  
Sbjct: 76  EGNSSPADVFLTENSPSMVLVDNANLFAPLDAGTLEQVAPQYRPSHGRWIGIAARSTVFV 135

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           Y+ +++  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K + 
Sbjct: 136 YNPEKLTEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMK 195

Query: 186 ANEILTKYK 194
            N   T YK
Sbjct: 196 TN--FTAYK 202


>gi|115372071|ref|ZP_01459383.1| bacterial extracellular solute-binding protein, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|310824710|ref|YP_003957068.1| iron ABC transporter periplasmic iron-binding protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115371036|gb|EAU69959.1| bacterial extracellular solute-binding protein, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|309397782|gb|ADO75241.1| Iron ABC transporter, periplasmic iron-binding protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 328

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 82/173 (47%), Gaps = 6/173 (3%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDV 76
           S  +  + LT+Y+ +N+ ++ P+  +F  +TG+++   Y  + Q     + +G  SP DV
Sbjct: 15  SAVHAAETLTVYSGRNERLVGPLYKAFTAKTGIEVKVRYGETPQLVATLMEEGAKSPADV 74

Query: 77  IITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
            + +D  +L       LL  LP   ++K     ++     + +S   +V+AY+T ++K  
Sbjct: 75  FVAQDAGALGALAKAQLLQPLPKAQVEKVDARFRSPEALWVGLSGRARVVAYNTAKVKPE 134

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            LP  +   T   WK R+  AP N SF   +  +         + +++ + AN
Sbjct: 135 QLPTGIQGFTEPAWKGRIGWAPTNGSFQAFVTALRLMKGDAAAKKWLEGVKAN 187


>gi|313902584|ref|ZP_07835984.1| extracellular solute-binding protein family 1 [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467150|gb|EFR62664.1| extracellular solute-binding protein family 1 [Thermaerobacter
           subterraneus DSM 13965]
          Length = 403

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 93/187 (49%), Gaps = 12/187 (6%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RP 66
           ++L  CG           + L +Y+ + QS++ P++  F + TG+ I   Y S+ +    
Sbjct: 81  FVLAGCG-----PLGGGNQQLVIYSSRTQSLVHPLLEQFAKETGIDIRVRYGSTAELVNT 135

Query: 67  PITQG--SPVDVIITKDETSLA-LNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +G  +  DV+   D      L E  LL +LP  +++K     ++ + + + +S  ++
Sbjct: 136 LLEEGDRTEADVLYLSDAGGWGPLREAGLLAQLPQDVLEKVDPRFRSPDGQWVGVSGRSK 195

Query: 123 VLAYSTKRIKIA-DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
           V+ Y+  RI  A DLP SV  LT+ +WK R+  AP +  +  L+  +  T  +   + ++
Sbjct: 196 VIVYNKDRIDPARDLPDSVMALTDPKWKGRVGWAPTHGEWQILVTAIRLTRGEEAARQWL 255

Query: 182 KNITANE 188
           + + ANE
Sbjct: 256 EGMKANE 262


>gi|70730403|ref|YP_260144.1| iron(III) ABC transporter periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68344702|gb|AAY92308.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 337

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 89/198 (44%), Gaps = 16/198 (8%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI------ 55
            K  +    LL  G   A   +     L +Y  Q++ +    +  F   TG+K+      
Sbjct: 9   LKAGLLVGALLTAGHAYAADADG----LLVYNAQHEGLTKAWVEGFTRDTGIKVTLRNGD 64

Query: 56  -SPIYTSSIQRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
            S +    +Q     Q SP DV +T++  ++AL  N  L  K+    +++ +   +  + 
Sbjct: 65  DSEMGNQMVQE---GQASPADVFLTENSPAMALVDNAGLFAKVAPTTLEQVAAAYRPTHG 121

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
             + I+  + V  Y+  +++ ADLPKS+ DL N  WK R + +P    F  +++ + +  
Sbjct: 122 NWVGIAARSTVFVYNPAKLQQADLPKSLLDLANPAWKGRWAASPAGADFQAIVSAVLELK 181

Query: 173 NKTVVQDFIKNITANEIL 190
            +    +++K + +N  L
Sbjct: 182 GEAATLEWLKGMKSNASL 199


>gi|260466700|ref|ZP_05812887.1| extracellular solute-binding protein family 1 [Mesorhizobium
           opportunistum WSM2075]
 gi|259029563|gb|EEW30852.1| extracellular solute-binding protein family 1 [Mesorhizobium
           opportunistum WSM2075]
          Length = 348

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 83/170 (48%), Gaps = 8/170 (4%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPVDVIITKDETSLA 86
           +Y  Q++S+       F + TG+K++      S      + +G  SP DV +T++  ++ 
Sbjct: 45  VYNAQHESLAKEWAAGFTKETGIKVTLRNGGDSDFSNQIVAEGTASPADVFLTENSPAMV 104

Query: 87  L--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L  N  L   + A  + +     +  + K + ++  + V AY+T ++K   LPKS+ DL 
Sbjct: 105 LVENAGLFAPVDADTLAQVPQDYQAASGKWVGVAARSTVFAYNTTKLKADQLPKSLLDLA 164

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           +  WK R + +P+   F  +++ + Q   +    D++K + AN   T YK
Sbjct: 165 DPSWKGRWAASPSGADFQAIVSALLQLKGEAATADWLKAMKAN--FTAYK 212


>gi|221635940|ref|YP_002523816.1| extracellular solute-binding protein, family 1 [Thermomicrobium
           roseum DSM 5159]
 gi|221157680|gb|ACM06798.1| extracellular solute-binding protein, family 1 [Thermomicrobium
           roseum DSM 5159]
          Length = 382

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 87/172 (50%), Gaps = 7/172 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVI 77
           T + +  +T+Y+ +++S++ P++    +  G+ +   Y  T+ +    + +G  SP D+ 
Sbjct: 69  TRSQSAVVTIYSGRSKSLIGPLLDRIGQELGLDVRVRYGDTAELATAILEEGDRSPADLF 128

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
             +D  +L     E  L  LP+ L+++     ++     + IS   + + Y+T+R+K  +
Sbjct: 129 FGQDAGALGALAKEGRLAPLPSELLQRVPQPYRSPKGLWVGISGRVRTVIYNTERVKPEE 188

Query: 136 LPKSVFDLT-NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           +P S+ D   N +W+ RL  AP N SF   +  + +   + V + +++ + A
Sbjct: 189 IPASIVDFAGNERWRARLGWAPTNGSFQAFVTALRRLRGEDVARSWLQGVKA 240


>gi|296160752|ref|ZP_06843566.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           Ch1-1]
 gi|295889055|gb|EFG68859.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           Ch1-1]
          Length = 343

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 91/187 (48%), Gaps = 15/187 (8%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQ 64
           L+L  F    S       +TLY  Q++ V+  +   FE+++G+ +       P   + I 
Sbjct: 19  LMLAAFATMPSAAQAAS-ITLYNAQHEQVVNLLARDFEKQSGISVKIRNGEGPAMAAQI- 76

Query: 65  RPPITQGS--PVDVIITKDETSLALNED--LLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
              + +G+  P DV  T++   L L E+  LL K+ +  +        + +   + ++  
Sbjct: 77  ---VAEGAATPADVYFTENSPELMLLEEKGLLSKVDSSTLATVPARFSSPSGAWVAVTAR 133

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
             VLAY+T +++ A LP+S+FDL   +WK ++ IAP++  F  L++ +     +     +
Sbjct: 134 ENVLAYNTTKVQAAQLPQSLFDLARPEWKGKIGIAPSDGDFLPLVSAVLALKGEAQTVQW 193

Query: 181 IKNITAN 187
           +K + AN
Sbjct: 194 LKGLKAN 200


>gi|288957451|ref|YP_003447792.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
 gi|288909759|dbj|BAI71248.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
          Length = 347

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 6/172 (3%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVI 77
           T  + + +T+Y  Q+ S+    +  F   TG+K++    S ++     + +G  SP DV 
Sbjct: 34  TAPSAEGITVYNAQHASLAKEWVERFSRETGIKVTVRNGSDMELGNQIVQEGAASPADVF 93

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           +T++  ++AL  N  L   L A  +       +  N   + I+  + V AY+T ++    
Sbjct: 94  LTENSPAMALVDNAGLFAPLGAETLASVPENFRPANGHWVGIAARSTVFAYNTGKLTRDK 153

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           LPKS+ DL   +WK R + +P    F  ++  + Q   +T    ++K +  N
Sbjct: 154 LPKSLLDLATPEWKGRWAASPAGADFQAIVGALLQLKGETATASWLKAMKEN 205


>gi|219849292|ref|YP_002463725.1| extracellular solute-binding protein family 1 protein [Chloroflexus
           aggregans DSM 9485]
 gi|219543551|gb|ACL25289.1| extracellular solute-binding protein family 1 [Chloroflexus
           aggregans DSM 9485]
          Length = 349

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 90/181 (49%), Gaps = 23/181 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDETS 84
           L +Y+ +++S++ P    F E TG+ +   Y  T+ +    + +G  SP D+   +D  +
Sbjct: 44  LVVYSGRSESLVGPFFTRFTEATGIPVEVRYGDTAELAATILEEGANSPADLFFAQDAGA 103

Query: 85  ----------LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
                     + L+ D+L+++ A          ++ + + + IS   +V+ Y+T ++  A
Sbjct: 104 LGALAAADVLIPLSTDILNQVEARF--------RSSDGRWVGISGRARVVVYNTNKLTEA 155

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           DLP+S+    + QW+ R+  AP N SF   +  M     +   + +++ + ANE+ T Y+
Sbjct: 156 DLPRSITGFVDPQWRGRVGWAPTNGSFQAFITAMRVQLGEEATRKWLEGMIANEVKT-YE 214

Query: 195 R 195
           R
Sbjct: 215 R 215


>gi|119511514|ref|ZP_01630623.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
 gi|119463825|gb|EAW44753.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
          Length = 349

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 81/167 (48%), Gaps = 6/167 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDE 82
           K L +Y+ +N+ ++  +I  FE +   K+   Y  T+ +    + +G  SP DV   +D 
Sbjct: 43  KELVIYSGRNEKLIGELIKQFETQANTKVQVRYGDTAELASAILEEGTNSPADVFFAQDA 102

Query: 83  TSLALNEDLLH--KLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L   +      +LP  L+ K     ++   + + ++   + + Y+T  +K  +LP S+
Sbjct: 103 GALGAIQKAGRTVELPTSLLNKVDSAYRSPEGQWVGVTGRVRTVDYNTNLVKAEELPSSI 162

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           F  T+ +W+ ++  AP N SF   +  +     +   +++++ I AN
Sbjct: 163 FGFTDPKWQGKIGWAPTNGSFQSFVTALRVAEGEERAKEWLEGIKAN 209


>gi|291296393|ref|YP_003507791.1| extracellular solute-binding protein family 1 [Meiothermus ruber
           DSM 1279]
 gi|290471352|gb|ADD28771.1| extracellular solute-binding protein family 1 [Meiothermus ruber
           DSM 1279]
          Length = 328

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 90/193 (46%), Gaps = 13/193 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           K  + T LL + G  +A       + LT+YT + Q ++ P++  FE  TG+K++  Y   
Sbjct: 4   KAVLVTTLLAVLGLAQA-----QQQSLTVYTGRGQGLVEPLVRQFEAETGIKVNVRYGRD 58

Query: 63  IQRPPITQG----SPVDVII--TKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
            +     Q     SP DV    T     +A    LL +L   + +  ++ +   +++ + 
Sbjct: 59  AEILAALQEEGSRSPADVFWANTAGALGVASERGLLVRLGDTITRTPAYFVP-ASRQWVP 117

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
           ++   +VLAY   R+K  DLPKS+ DL    Q+K R+   P   SF  ++  M     + 
Sbjct: 118 LTVRLRVLAYDPSRVKPEDLPKSIMDLPKLTQYKGRIGWTPTYSSFQDMIAAMVAQYGEA 177

Query: 176 VVQDFIKNITANE 188
             + +I ++ A E
Sbjct: 178 RTRQWIADMKALE 190


>gi|326444113|ref|ZP_08218847.1| iron ABC transporter periplasmic iron-binding protein [Streptomyces
           clavuligerus ATCC 27064]
          Length = 352

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 84/177 (47%), Gaps = 9/177 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--S 72
           TEA   +   K L +Y+ +N+ ++ PII   E+ TG  +   Y  S +     + +G  +
Sbjct: 37  TEAGEQKGAEK-LVIYSGRNEELISPIIGKLEKATGTDVEVRYGDSAELAAQILEEGDRT 95

Query: 73  PVDVIITKDETSL-ALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
              +  ++D  +L AL++   L KLP   + K     +   +  + +S  ++V+AY+ K 
Sbjct: 96  KAGLFFSQDAGALGALSQAGQLAKLPQKSLDKVDAAFRGGEQDWVGVSGRSRVIAYNPKS 155

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
                +P S+ DLT  +WK ++  AP N SF   +  M     +     ++K + AN
Sbjct: 156 A--GKVPDSIHDLTAPKWKGKVGYAPTNASFQAFVTGMRVLEGEDATLKWLKGLKAN 210


>gi|119511513|ref|ZP_01630622.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
 gi|119463824|gb|EAW44752.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
          Length = 330

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 85/177 (48%), Gaps = 6/177 (3%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPV 74
             S    TK LT+Y+ + + ++ P++   ++  G+ I   Y  T+ +    + +G  S  
Sbjct: 17  GLSVNAQTKTLTIYSGRGEKLIGPLLEQAKKDLGMNIQVRYGDTAELAIALVEEGKNSRA 76

Query: 75  DVIITKDETSLALNEDLLHKLP--AHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           D+   +D  +L L E     LP  ++L+ +     ++   K + IS   + L Y+T  +K
Sbjct: 77  DLYFAQDAGALGLLERRNLTLPISSNLLNQVDPRFRSPQGKWLGISGRARTLNYNTNLVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
              LPKSV+DL   QW+ +++ AP N SF   +  M     +     ++K + AN +
Sbjct: 137 KEQLPKSVWDLVKPQWRGKVAWAPTNGSFQSFVTAMRVLEGEPRTLQWLKAMKANGV 193


>gi|187919532|ref|YP_001888563.1| family 1 extracellular solute-binding protein [Burkholderia
           phytofirmans PsJN]
 gi|187717970|gb|ACD19193.1| extracellular solute-binding protein family 1 [Burkholderia
           phytofirmans PsJN]
          Length = 347

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 95/198 (47%), Gaps = 18/198 (9%)

Query: 4   RTIYTYLLLLCGFT-EAFST---ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI---- 55
           R + T L      T  AF+T         +TLY  Q++ V+  +   FE+++G+ +    
Sbjct: 11  RAVATSLGSAVALTLAAFATVPSAAEAASITLYNAQHEQVVNLLAKDFEKQSGISVKIRN 70

Query: 56  --SPIYTSSIQRPPITQGS--PVDVIITKDETSLALNED--LLHKLPAHLIKKNSFVLKN 109
              P   + I    + +G+  P DV  T++   L L E+  LL+K+ A  +        +
Sbjct: 71  GEGPAMAAQI----VAEGAATPADVYFTENSPELMLLEEKGLLNKVDASTLATVPARFNS 126

Query: 110 ENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTME 169
                + ++    VLAY+T +++ + LP+S+FDL   +WK ++ IAP++  F  L++ + 
Sbjct: 127 PTGAWVAVTARENVLAYNTTKVQASQLPQSLFDLAKPEWKGKIGIAPSDGDFLPLVSAVL 186

Query: 170 QTPNKTVVQDFIKNITAN 187
               +     ++K + AN
Sbjct: 187 ALKGEAQTVQWLKGLKAN 204


>gi|294815767|ref|ZP_06774410.1| ABC-type Fe3+ transport system, periplasmic component [Streptomyces
           clavuligerus ATCC 27064]
 gi|294328366|gb|EFG10009.1| ABC-type Fe3+ transport system, periplasmic component [Streptomyces
           clavuligerus ATCC 27064]
          Length = 378

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 84/177 (47%), Gaps = 9/177 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--S 72
           TEA   +   K L +Y+ +N+ ++ PII   E+ TG  +   Y  S +     + +G  +
Sbjct: 63  TEAGEQKGAEK-LVIYSGRNEELISPIIGKLEKATGTDVEVRYGDSAELAAQILEEGDRT 121

Query: 73  PVDVIITKDETSL-ALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
              +  ++D  +L AL++   L KLP   + K     +   +  + +S  ++V+AY+ K 
Sbjct: 122 KAGLFFSQDAGALGALSQAGQLAKLPQKSLDKVDAAFRGGEQDWVGVSGRSRVIAYNPK- 180

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
                +P S+ DLT  +WK ++  AP N SF   +  M     +     ++K + AN
Sbjct: 181 -SAGKVPDSIHDLTAPKWKGKVGYAPTNASFQAFVTGMRVLEGEDATLKWLKGLKAN 236


>gi|91778275|ref|YP_553483.1| ABC Fe+3 transporter, periplasmic ligand binding protein
           [Burkholderia xenovorans LB400]
 gi|91690935|gb|ABE34133.1| ABC Fe+3 transporter, periplasmic ligand binding protein
           [Burkholderia xenovorans LB400]
          Length = 343

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 85/169 (50%), Gaps = 14/169 (8%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQRPPITQGS--PVDVIITK 80
           +TLY  Q++ V+  +   FE+++G+ +       P   + I    + +G+  P DV  T+
Sbjct: 36  ITLYNAQHEQVVNLLAKDFEKQSGISVKIRNGEGPAMAAQI----VAEGAATPADVYFTE 91

Query: 81  DETSLALNED--LLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
           +   L L E+  LL K+ A  +        +     + ++    VLAY+T +++ + LP+
Sbjct: 92  NSPELMLLEEKGLLSKVDASTLATVPARFSSPTGAWVAVTARENVLAYNTAKVQASQLPQ 151

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           S+FDL   +WK ++ IAP++  F  L++ +     +     ++K + AN
Sbjct: 152 SLFDLARPEWKGKIGIAPSDGDFLPLVSAVLALKGEAQTVQWLKGLKAN 200


>gi|271500997|ref|YP_003334022.1| family 1 extracellular solute-binding protein [Dickeya dadantii
           Ech586]
 gi|270344552|gb|ACZ77317.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech586]
          Length = 338

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 92/189 (48%), Gaps = 10/189 (5%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           L+ G +  F  +     + +Y  Q+++++   +  F + TG+K++      S +    + 
Sbjct: 18  LMMGLS--FGVQAEEAGIVIYNAQHENLVKSWVDGFTQDTGIKVTLRNGGDSELGNQLVQ 75

Query: 70  QGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +GS  P DV +T++  S+ L  N +L   L A  + +     +  + + + I+  + V  
Sbjct: 76  EGSASPADVFLTENSPSMVLVDNANLFAPLDADTLAQVEPQYRPSHGRWIGIAARSTVFV 135

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           Y+ +++  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    D++K + 
Sbjct: 136 YNPEKLTEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLDWLKAMK 195

Query: 186 ANEILTKYK 194
            N   T YK
Sbjct: 196 TN--FTAYK 202


>gi|13473018|ref|NP_104585.1| iron-binding periplasmic protein; sfuA protein precursor
           [Mesorhizobium loti MAFF303099]
 gi|14023766|dbj|BAB50371.1| iron-binding periplasmic protein; SfuA protein precursor
           [Mesorhizobium loti MAFF303099]
          Length = 335

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 82/170 (48%), Gaps = 8/170 (4%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPVDVIITKDETSLA 86
           +Y  Q++S+       F + TG+K++      S      + +G  SP DV +T++  ++ 
Sbjct: 32  VYNAQHESLAKEWAEGFTKETGIKVTLRNGGDSDFSNQIVAEGAASPADVFLTENSPAMV 91

Query: 87  L--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L  N  L   + A  + +     +  + K + ++  + V AY+T ++K   LPKS+ DL 
Sbjct: 92  LVENAGLFAPVDADTLAQVPQDYQATSGKWVGVAARSTVFAYNTTKLKADQLPKSLLDLA 151

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           +  WK R + +P+   F  +++ + Q   +    D++K +  N   T YK
Sbjct: 152 DPSWKGRWAASPSGADFQAIVSALLQLKGEAATADWLKAMKQN--FTAYK 199


>gi|209516403|ref|ZP_03265259.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           H160]
 gi|209503165|gb|EEA03165.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           H160]
          Length = 367

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 14/169 (8%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQRPPITQG--SPVDVIITK 80
           +TLY  Q++ V+  +   FE+++G+ +       P   + I    + +G  SP DV  T+
Sbjct: 60  ITLYNAQHEQVVNLLAKDFEKQSGISVKIRNGEGPALAAQI----VAEGAASPADVYFTE 115

Query: 81  DETSLALNED--LLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
           +   L L E+  LL K+ A  +        + +   + ++    VLAY+T +++ + LP+
Sbjct: 116 NSPELMLLEEKGLLAKVDAATLGTVPARFNSPSGVWVAVTARESVLAYNTTKLQPSQLPQ 175

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           SVFDL   +WK ++ IAP++  F  L++ +     +     ++K + AN
Sbjct: 176 SVFDLAKPEWKGKVGIAPSDADFLPLVSAVLALKGEEQTLAWLKGLKAN 224


>gi|108798950|ref|YP_639147.1| extracellular solute-binding protein [Mycobacterium sp. MCS]
 gi|119868065|ref|YP_938017.1| extracellular solute-binding protein [Mycobacterium sp. KMS]
 gi|126434550|ref|YP_001070241.1| extracellular solute-binding protein [Mycobacterium sp. JLS]
 gi|108769369|gb|ABG08091.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           MCS]
 gi|119694154|gb|ABL91227.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           KMS]
 gi|126234350|gb|ABN97750.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           JLS]
          Length = 342

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 6/178 (3%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPV 74
           A S+ + +  L +Y  Q++S+    I +F + TG+K+S      + +    + +G  SP 
Sbjct: 27  ACSSSDDSDELLIYNAQHESLTKEWIDAFTKETGIKVSYRQGGDTELGNQLVAEGDASPA 86

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DV +T++  ++A  E   L   L A  I +     +    K   ++  + V  Y+  R+K
Sbjct: 87  DVFLTENSPAMAAVERAGLFADLDAATIDQVPAQYRPATGKWTGVAARSTVFVYNPSRLK 146

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
              LPKS+ DL   +WK R    P    F  ++  + Q   +     ++  + AN ++
Sbjct: 147 ADQLPKSLLDLQQPEWKGRWGAPPAKADFQAIVAALLQLEGEPATAQWLAGMKANAVI 204


>gi|311280106|ref|YP_003942337.1| extracellular solute-binding protein family 1 [Enterobacter cloacae
           SCF1]
 gi|308749301|gb|ADO49053.1| extracellular solute-binding protein family 1 [Enterobacter cloacae
           SCF1]
          Length = 338

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 90/177 (50%), Gaps = 8/177 (4%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVIIT 79
           ++++ + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T
Sbjct: 28  DSSEGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGGDSELGNQLVQEGSASPADVFLT 87

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           ++  S+ L  N  L   L    +K+     + E+ + + I+  + V  Y+ +++  A LP
Sbjct: 88  ENSPSMVLVDNAKLFAPLDEATLKQVPAEYRPEHGRWIGIAARSTVFVYNPEKLSEAQLP 147

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           KS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   T YK
Sbjct: 148 KSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--FTAYK 202


>gi|296103514|ref|YP_003613660.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057973|gb|ADF62711.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 338

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 92/182 (50%), Gaps = 7/182 (3%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS-- 72
           T++F+ +N  + + +Y  Q+++++   +  F + TG+K++      S +    + +GS  
Sbjct: 22  TQSFAADNN-EGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDSELGNQLVQEGSAS 80

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV +T++  S+ L  N  L   L A  +K+     +  + + + I+  + V  Y+ ++
Sbjct: 81  PADVFLTENSPSMVLVDNAKLFASLDAETLKQVPAEYRPAHGRWIGIAARSTVFVYNPEK 140

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           +    LPKS+ DL   +WK R + +P+   F  +++ M     +    +++K + AN + 
Sbjct: 141 LSEQQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLEWLKAMKANFVA 200

Query: 191 TK 192
            K
Sbjct: 201 YK 202


>gi|238789970|ref|ZP_04633749.1| Iron(III)-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
 gi|238721918|gb|EEQ13579.1| Iron(III)-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
          Length = 338

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 93/192 (48%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    ++ + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMILAFSANAASSDEGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L      + +   + E+ +   I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDTATQAQVAKEYRPEHGRWTGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +    D++K
Sbjct: 133 VFVYNPEKISAAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLDWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|238784655|ref|ZP_04628660.1| Iron(III)-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
 gi|238714427|gb|EEQ06434.1| Iron(III)-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
          Length = 343

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 90/184 (48%), Gaps = 10/184 (5%)

Query: 19  AFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS-- 72
           AFS    +  K + +Y  Q+++++   +  F + TG+K++      S +    + +GS  
Sbjct: 26  AFSAHAASNDKSIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSAS 85

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + V  Y+ ++
Sbjct: 86  PADVFLTENSPAMVLVDNAKLFAPLDAETQAQVAKEYRPEHGRWSGIAARSTVFVYNPEK 145

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           I  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   
Sbjct: 146 ISEAQLPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--F 203

Query: 191 TKYK 194
           T YK
Sbjct: 204 TAYK 207


>gi|209526494|ref|ZP_03275021.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
 gi|209493129|gb|EDZ93457.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
          Length = 346

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 77/165 (46%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGSPVDVIITKDETS 84
           L +Y+ + + ++ P+   F+  TG++++  Y  + +         Q SP D+   +D  +
Sbjct: 43  LVVYSGRGEDLISPMFERFQAETGIQVNVRYGDTAELAATILEEGQNSPADIYFAQDAGA 102

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E     +P  L+ +     ++   + + I+   +V  Y+T  +    +P S+++
Sbjct: 103 LGALQREGRTRTIPETLLNQVDPRFRSREGQWIGITGRARVFNYNTNLLSSDQVPNSIWE 162

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           LT  +W  R+  AP N SF   +  + +   +   +++++ + AN
Sbjct: 163 LTQPEWSGRIGWAPTNGSFQSFVTALRKHEGEERAREWVEAMQAN 207


>gi|238764183|ref|ZP_04625136.1| Iron(III)-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
 gi|238697596|gb|EEP90360.1| Iron(III)-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
          Length = 338

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 94/192 (48%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSLMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +G  SP DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + 
Sbjct: 73  LVQEGGASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  ++LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 133 VFVYNPEKISESELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            + AN   T YK
Sbjct: 193 AMKAN--ATAYK 202


>gi|332162496|ref|YP_004299073.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666726|gb|ADZ43370.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863744|emb|CBX73843.1| Fe(3+)-binding periplasmic protein [Yersinia enterocolitica W22703]
          Length = 338

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 93/192 (48%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 133 VFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|107099639|ref|ZP_01363557.1| hypothetical protein PaerPA_01000655 [Pseudomonas aeruginosa PACS2]
          Length = 335

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGARSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL KL    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|254238574|ref|ZP_04931897.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa C3719]
 gi|126170505|gb|EAZ56016.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa C3719]
          Length = 335

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGARSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL KL    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|49087450|gb|AAT51460.1| PA4687 [synthetic construct]
          Length = 336

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGARSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL KL    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|15599882|ref|NP_253376.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAO1]
 gi|116052832|ref|YP_793149.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|296391509|ref|ZP_06880984.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAb1]
 gi|313107349|ref|ZP_07793543.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 39016]
 gi|9950944|gb|AAG08074.1|AE004882_5 ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAO1]
 gi|115588053|gb|ABJ14068.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|310880045|gb|EFQ38639.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 39016]
          Length = 335

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGARSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL KL    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|238759507|ref|ZP_04620670.1| Iron(III)-binding periplasmic protein [Yersinia aldovae ATCC 35236]
 gi|238702282|gb|EEP94836.1| Iron(III)-binding periplasmic protein [Yersinia aldovae ATCC 35236]
          Length = 338

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 93/192 (48%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSVLLAFSVNAASNDEGIVVYNAQHENLVKSWVEGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ + + I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQIAKEYRPEHGRWVGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 133 VFVYNPEKISAAQLPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKNN--FTAYK 202


>gi|123441578|ref|YP_001005564.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088539|emb|CAL11333.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 338

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 93/190 (48%), Gaps = 11/190 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPI 68
           ++L  +  A S +     + +Y  Q+++++   +  F + TG+K++      S +    +
Sbjct: 18  MMLAFYANAASNDEG---IVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLV 74

Query: 69  TQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + V 
Sbjct: 75  QEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTGIAARSTVF 134

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +
Sbjct: 135 VYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAM 194

Query: 185 TANEILTKYK 194
             N   T YK
Sbjct: 195 KTN--FTAYK 202


>gi|238751989|ref|ZP_04613474.1| Iron(III)-binding periplasmic protein [Yersinia rohdei ATCC 43380]
 gi|238709823|gb|EEQ02056.1| Iron(III)-binding periplasmic protein [Yersinia rohdei ATCC 43380]
          Length = 352

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 86/172 (50%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++      S +    + +G  SP DV +T++  +
Sbjct: 47  IVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGAASPADVFLTENSPA 106

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A+LPKS+ D
Sbjct: 107 MVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTGIAARSTVFVYNPEKISAAELPKSIMD 166

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++ M +   +    +++K +  N   T YK
Sbjct: 167 LAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTNS--TAYK 216


>gi|50122060|ref|YP_051227.1| iron(III)-binding periplasmic protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49612586|emb|CAG76036.1| iron(III)-binding periplasmic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 338

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 95/196 (48%), Gaps = 12/196 (6%)

Query: 8   TYLLLLCGFT---EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-- 62
           + +LL  G T    A + EN  + + +Y  Q+++++   +  F + TG+K++    S   
Sbjct: 10  SAVLLASGLTLSASANAAEND-EGIVIYNAQHENLVKSWVDGFTKETGIKVTLRSGSDTE 68

Query: 63  IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
           +    + +G  SP DV +T++  S+ L  N DL   L    + + +   +  + + + I+
Sbjct: 69  LGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKATLAQVAPDYRPSHGRWVGIA 128

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V  Y+  +   A LPKS+ DL   +WK R + +P+   F  +++   +   +   Q
Sbjct: 129 ARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLEQKGEKATQ 188

Query: 179 DFIKNITANEILTKYK 194
           +++K +  N   T YK
Sbjct: 189 EWLKGMKEN--FTAYK 202


>gi|271969332|ref|YP_003343528.1| iron ABC transporter periplasmic iron-binding protein
           [Streptosporangium roseum DSM 43021]
 gi|270512507|gb|ACZ90785.1| iron ABC transporter, periplasmic iron-binding protein
           [Streptosporangium roseum DSM 43021]
          Length = 340

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 81/180 (45%), Gaps = 8/180 (4%)

Query: 14  CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG 71
           CG             L +Y+ +N++++ P+I      TG+ +   Y  S +     + +G
Sbjct: 21  CGGDGGDGQSFGDDSLVIYSGRNKNLVGPLIDKLRTATGLDVQVRYGDSAELAAQILEEG 80

Query: 72  --SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
             S  DV  ++D  +L       +L  +P  L+ + +   +      + +S  ++V+ Y 
Sbjct: 81  ADSRADVFFSQDAGALGALSKHRMLAPVPPELLDRVAARYRGSEGTWVGVSGRSRVIVYD 140

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +   +A  PKSVF+LT  +WK ++  +P N SF   +  +     +   + +++ + AN
Sbjct: 141 PR--TVAAPPKSVFELTGPKWKDKVGWSPTNASFQSFVTALRVVAGEDRARQWLEAMKAN 198


>gi|254244411|ref|ZP_04937733.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 2192]
 gi|126197789|gb|EAZ61852.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 2192]
          Length = 335

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGARSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL KL    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLAKLEPETLALVEPEHAGGNGDWVGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPTWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|326332539|ref|ZP_08198811.1| iron(III)-binding protein [Nocardioidaceae bacterium Broad-1]
 gi|325949662|gb|EGD41730.1| iron(III)-binding protein [Nocardioidaceae bacterium Broad-1]
          Length = 336

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 80/170 (47%), Gaps = 6/170 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIIT 79
           ++   L +Y  Q++ +M  ++ +FE+ TG+ +       ++     + +G  SP DV +T
Sbjct: 26  SSGDALVVYNAQHEQLMEELVPAFEKETGIDVELRNGKDLELAAQLVAEGEKSPADVFLT 85

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           ++  ++A    E LL  LP  +        +  +         + VL Y+T  I  A+LP
Sbjct: 86  ENSPAMAAVEREGLLATLPDDVTAPIPEQYRPTSNAWTGFVARSTVLVYNTDEITEAELP 145

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            S+ DL   +WK ++S +P    F  ++  +  T  +   + +++ I AN
Sbjct: 146 ASMLDLAKPEWKGKVSFSPTGADFQAIVAGVLATEGEAATKAWLEGIKAN 195


>gi|152988703|ref|YP_001350724.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PA7]
 gi|150963861|gb|ABR85886.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PA7]
          Length = 335

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 6/164 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETS 84
           LTLY  Q+ +  + I  +F+++TG  VKI       +      +G  SP DV+ T++   
Sbjct: 32  LTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQITEEGERSPADVLYTEESPP 91

Query: 85  LA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L    +  LL +L    +          N   + I+  T+VLAY+ K+I   DLPKS+ D
Sbjct: 92  LIRLASAGLLARLEPETLALVEPEHAGGNGDWIGITARTRVLAYNPKKIDEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L++  W  R    P + +F   +  + +   +   +D++  + A
Sbjct: 152 LSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLTGLKA 195


>gi|61679630|pdb|1XVX|A Chain A, Crystal Structure Of Iron-Loaded Yersinia Enterocolitica
           Yfua
          Length = 312

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 88/178 (49%), Gaps = 8/178 (4%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVII 78
           E+    + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +
Sbjct: 1   ESNDSGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFL 60

Query: 79  TKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
           T++  ++ L  N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A+L
Sbjct: 61  TENSPAMVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAEL 120

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           PKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   T YK
Sbjct: 121 PKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--FTAYK 176


>gi|319781302|ref|YP_004140778.1| extracellular solute-binding protein family 1 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167190|gb|ADV10728.1| extracellular solute-binding protein family 1 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 335

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 81/170 (47%), Gaps = 8/170 (4%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPVDVIITKDETSLA 86
           +Y  Q++S+       F + TG+K++      S      + +G  SP DV +T++  ++A
Sbjct: 32  VYNAQHESLTKAWAEGFTKETGIKVTVRNGGDSDFSNQIVAEGAASPADVFLTENSPAMA 91

Query: 87  LNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L E   L   + A  + +     +  + K + ++  + V AY+  ++    LPKS+ DL 
Sbjct: 92  LVESAGLFAPVDADTLAQVPQDYQPASGKWVGVAARSTVFAYNKTKLTADQLPKSMLDLA 151

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           +  WK R + +P+   F  +++ + Q   +    D++K +  N   T YK
Sbjct: 152 DPSWKGRWAASPSGADFQAIVSALLQLKGEAATADWLKAMKTN--FTAYK 199


>gi|284052464|ref|ZP_06382674.1| extracellular solute-binding protein [Arthrospira platensis str.
           Paraca]
 gi|291566591|dbj|BAI88863.1| putative iron ABC transporter ATP-binding protein [Arthrospira
           platensis NIES-39]
          Length = 346

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 77/165 (46%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGSPVDVIITKDETS 84
           L +Y+ + + ++ P+   F+  TG++++  Y  + +         Q SP D+   +D  +
Sbjct: 43  LVVYSGRAEDLIGPMFQRFQAETGIQVNVRYGDTAELAATILEEGQNSPADIYFAQDAGA 102

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E     +P  L+ +     ++   + + I+   +V  Y+T  +    +P S+++
Sbjct: 103 LGALQREGRTRPIPETLLNQVDPRFRSREGQWIGITGRARVFNYNTDLLSSDQVPNSIWE 162

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +T  +W  R+  AP N SF   +  + +   +   +++++ + AN
Sbjct: 163 ITQPEWSGRIGWAPTNGSFQSFVTALRKHEGEERAREWVEAMQAN 207


>gi|297567102|ref|YP_003686074.1| family 1 extracellular solute-binding protein [Meiothermus silvanus
           DSM 9946]
 gi|296851551|gb|ADH64566.1| extracellular solute-binding protein family 1 [Meiothermus silvanus
           DSM 9946]
          Length = 353

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 85/176 (48%), Gaps = 10/176 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPV 74
           A       + LTLYT ++Q+++  ++  F++ TG+K++  Y    +     Q     SP 
Sbjct: 14  ALGVAQAQQSLTLYTGRSQALVDKLVQQFQKDTGIKVNVRYGRDAEILAALQEEGSRSPA 73

Query: 75  DVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV       +L  A+  +LL +LPA L ++   FV    + + + +S   +V AY+  ++
Sbjct: 74  DVFWANTSGALEEAVKRNLLVQLPASLTRQPQEFV--PSHGRWVPVSVRFRVAAYNPTKV 131

Query: 132 KIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           K +D P SV DL   A++K R+   P   SF   +  M     +   + +++ + A
Sbjct: 132 KDSDFPASVMDLPKVAKFKGRIGWTPTYSSFQDFITAMRVVKGEAATKAWLQAMIA 187


>gi|331700342|ref|YP_004336581.1| extracellular solute-binding protein family 1 [Pseudonocardia
           dioxanivorans CB1190]
 gi|326955031|gb|AEA28728.1| extracellular solute-binding protein family 1 [Pseudonocardia
           dioxanivorans CB1190]
          Length = 348

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 83/168 (49%), Gaps = 6/168 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDE 82
           + L +Y+ + ++++  +I  FE+ +G+K+   Y S+ +     + +G  +P  V ++++ 
Sbjct: 42  RTLVVYSGREEALVGELIKQFEQTSGIKVETRYGSTTELAAQLLEEGDRTPAQVFLSQES 101

Query: 83  TSLALNEDLLH--KLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L       H   LPA +         +++   + ++   +V+AY ++      +P  +
Sbjct: 102 GALGAVAAAGHLTTLPADVTSAVPANYTSKDGSWVGLTGRARVIAYDSRTYAADQVPGDI 161

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            +L   QWK +++IAP N SF   +  +  T  +   + +++ + ANE
Sbjct: 162 TELVQPQWKGKIAIAPTNASFQAHVTALRVTAGEEAARAWVQGLKANE 209


>gi|253689288|ref|YP_003018478.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251755866|gb|ACT13942.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 338

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 84/172 (48%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++    S   +    + +G  SP DV +T++  S
Sbjct: 33  IVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDTELGNQLVQEGKSSPADVFLTENSPS 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N DL   L    + + S   +  + + + I+  + V  Y+  +   A LPKS+ D
Sbjct: 93  MVLVDNADLFAPLDKATLAQVSSDYRPSHGRWIGIAARSTVFVYNPTKFTDAQLPKSLAD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++   +   +   Q+++K +  N   T YK
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSAYLELKGEKATQEWLKGMKEN--FTAYK 202


>gi|619573|emb|CAA87394.1| YfuA precursor [Yersinia enterocolitica (type O:8)]
          Length = 338

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 92/192 (47%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS   E+    + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMMLAFSANAESNDGGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAVTQAQVAQEYRREHGRWTGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  A+L KS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 133 VFVYNPEKISKAELAKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|238791996|ref|ZP_04635632.1| Iron(III)-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
 gi|238728627|gb|EEQ20145.1| Iron(III)-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
          Length = 373

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 92/192 (47%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 48  LLASSMMLAFSVNAASNDEGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 107

Query: 67  PITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +G  SP DV +T++  ++ L  N  L   L      + +   + E+ +   I+  + 
Sbjct: 108 LVQEGNSSPADVFLTENSPAMVLVDNAKLFSPLDTATQAQVAKEYRPEHGRWTGIAARST 167

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 168 VFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 227

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 228 AMKTN--FTAYK 237


>gi|312958660|ref|ZP_07773180.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311287203|gb|EFQ65764.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 341

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 84/174 (48%), Gaps = 8/174 (4%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPV 74
           A+S +  +  LTLY  Q++ V   +  +FE RTG+ ++    SS Q     + +G  SP 
Sbjct: 30  AYSADKVS--LTLYNGQHKEVGDELAKAFEARTGIHVNVRKGSSNQLASQVVEEGDRSPA 87

Query: 75  DVIITKDETSL-ALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DVI T++   L  L E  LL ++ A  +          N   M ++  T+V+A++ K I 
Sbjct: 88  DVIYTEESPPLNKLGEQGLLARIDAGTLDVLPKDYVGRNGDWMGVTARTRVVAFNPKLIA 147

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
             DLPKSV D    +W+ ++   P + +F      + +   +   ++++  + A
Sbjct: 148 EKDLPKSVLDFAAPEWQGKVGFVPTSGAFQEQAVAIIKLHGREAAEEWLTGLRA 201


>gi|288922155|ref|ZP_06416357.1| extracellular solute-binding protein family 1 [Frankia sp. EUN1f]
 gi|288346515|gb|EFC80842.1| extracellular solute-binding protein family 1 [Frankia sp. EUN1f]
          Length = 343

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 82/184 (44%), Gaps = 8/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPP 67
           L  CG   + ++      L LY  Q+  V       F  +TG+K+  I   S   +    
Sbjct: 20  LAACGSDSSPASSGPDGALVLYNAQHDEVGKAWADGFTAKTGIKVD-IRNGSDFELANQI 78

Query: 68  ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQV 123
           + +G  SP DV IT++  +++L   + L   + A    +      +     + ++  + V
Sbjct: 79  VAEGESSPADVFITENSPAMSLVSAKGLFAPVDAATRAQVPARYSSGKGDWVGVAARSTV 138

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKN 183
             Y+  +I  ADLPKS+ DL   +WK R +++P+   F  +++ +     +   + +++ 
Sbjct: 139 FIYNPGKIPAADLPKSIIDLARPEWKGRYAVSPSGADFQAVVSAVYALRGQDEGRAWLQG 198

Query: 184 ITAN 187
           I  N
Sbjct: 199 IKDN 202


>gi|238798707|ref|ZP_04642180.1| Iron(III)-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
 gi|238717464|gb|EEQ09307.1| Iron(III)-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
          Length = 343

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 90/184 (48%), Gaps = 10/184 (5%)

Query: 19  AFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS-- 72
           AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +    + +GS  
Sbjct: 26  AFSAHAASNDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRNGGDSELGNQLVQEGSAS 85

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV +T++  ++ L  N  L   L A    + +   + ++ +   I+  + V  Y+ ++
Sbjct: 86  PADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPDHGRWTGIAARSTVFVYNPEK 145

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           I  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   
Sbjct: 146 ISEAQLPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--F 203

Query: 191 TKYK 194
           T YK
Sbjct: 204 TAYK 207


>gi|318606576|emb|CBY28074.1| ferric iron ABC transporter, iron-binding protein [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 338

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 92/192 (47%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+ ++I   +LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K
Sbjct: 133 VFVYNPEKISETELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|206579888|ref|YP_002239383.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Klebsiella pneumoniae 342]
 gi|288936233|ref|YP_003440292.1| extracellular solute-binding protein family 1 [Klebsiella variicola
           At-22]
 gi|290510711|ref|ZP_06550081.1| iron(III) transport system substrate-binding protein [Klebsiella
           sp. 1_1_55]
 gi|206568946|gb|ACI10722.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Klebsiella pneumoniae 342]
 gi|288890942|gb|ADC59260.1| extracellular solute-binding protein family 1 [Klebsiella variicola
           At-22]
 gi|289777427|gb|EFD85425.1| iron(III) transport system substrate-binding protein [Klebsiella
           sp. 1_1_55]
          Length = 338

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T++  S
Sbjct: 33  IVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDSELGNQLVQEGSASPADVFLTENSPS 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   L A  +++     + ++ + + I+  + V  Y+  +I  A LP S+ D
Sbjct: 93  MVLVDNAKLFAPLDAATLQQVPAQYRPQHGRWIGIAARSTVFVYNPAKISEAQLPHSLMD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           L   +WK R + +P+   F  +++ M     +    D++K +  N +  K
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLDWLKAMKTNFVAYK 202


>gi|238894034|ref|YP_002918768.1| iron(III)-binding periplasmic protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238546350|dbj|BAH62701.1| iron(III)-binding periplasmic protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 338

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T++  S
Sbjct: 33  IVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDSELGNQLVQEGSASPADVFLTENSPS 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   L A  +++     + ++ + + I+  + V  Y+  +I  A LP S+ D
Sbjct: 93  MVLVDNAKLFAPLDAATLQQVPAQYRPQHGRWIGIAARSTVFVYNPAKISEAQLPHSLMD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           L   +WK R + +P+   F  +++ M     +    D++K +  N +  K
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLDWLKAMKTNFVAYK 202


>gi|119963832|ref|YP_946554.1| iron(III)-binding protein [Arthrobacter aurescens TC1]
 gi|119950691|gb|ABM09602.1| iron(III)-binding protein [Arthrobacter aurescens TC1]
          Length = 349

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 89/194 (45%), Gaps = 11/194 (5%)

Query: 5   TIYTYLLLLCGF---TEAFSTENTTKY--LTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
            I T  L  CG    T   S+E+      +T+Y  Q++S+    I +F + TG+K++   
Sbjct: 15  AIATLGLSACGSNTTTAPDSSESAAAGDGITVYNAQHESLTKEWIDAFTKETGIKVTLRQ 74

Query: 60  TSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKK 113
            S  +     + +G  SP DV +T++  ++A   N  L   +    + +     +    K
Sbjct: 75  GSDTEMSNQIVQEGAASPADVFLTENSPAMAQVENAGLFADVDKATVDQVPAEFRPSTGK 134

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
              I+  + VL Y   +I    LPKS+ DL   +WK + + +P+   F  +++ + +   
Sbjct: 135 WTGIAARSTVLVYDKNKISDDQLPKSMLDLAKPEWKGKWAASPSGADFQAIVSALLELKG 194

Query: 174 KTVVQDFIKNITAN 187
           +   ++++K +  N
Sbjct: 195 EAATEEWLKGMKDN 208


>gi|261820665|ref|YP_003258771.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
 gi|261604678|gb|ACX87164.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
          Length = 338

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 93/194 (47%), Gaps = 12/194 (6%)

Query: 10  LLLLCGFT---EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQ 64
           +LL  G T    A + EN  + + +Y  Q+++++   +  F + TG+K++    S   + 
Sbjct: 12  VLLASGLTLGTSANAAEND-EGIVIYNAQHENLVKSWVDGFTKETGIKVTLRSGSDTELG 70

Query: 65  RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
              + +G  SP DV +T++  S+ L  N DL   L    + + +   +  + + + I+  
Sbjct: 71  NQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKATLAQVAPDYRPSHGRWIGIAAR 130

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
           + V  Y+  +   A LP S+ DL   +WK R + +P+   F  +++   +   +   Q++
Sbjct: 131 STVFVYNPTKFTDAQLPTSLADLAKPEWKGRWAASPSGADFQAIVSAYLELKGEKATQEW 190

Query: 181 IKNITANEILTKYK 194
           +K +  N   T YK
Sbjct: 191 LKGMKEN--FTAYK 202


>gi|170023704|ref|YP_001720209.1| extracellular solute-binding protein [Yersinia pseudotuberculosis
           YPIII]
 gi|169750238|gb|ACA67756.1| extracellular solute-binding protein family 1 [Yersinia
           pseudotuberculosis YPIII]
          Length = 339

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 88/190 (46%), Gaps = 11/190 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPI 68
           +L      A S E+    + +Y  Q++S        F + TG+K++      S +    I
Sbjct: 18  ILFASSANAASDEDG---IIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLI 74

Query: 69  TQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +GS  P DV +T++  ++ L  N  L   L A  + + +   + E+ +   I+  + V 
Sbjct: 75  QEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVAKEYRPEDGRWTGIAARSTVF 134

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            Y+  +I  ++LPKS+ DL   +WK R + +P+   F  +++ M     +    +++K +
Sbjct: 135 VYNPAKISESELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLEWLKAM 194

Query: 185 TANEILTKYK 194
             N   T YK
Sbjct: 195 KTN--ATAYK 202


>gi|119716254|ref|YP_923219.1| extracellular solute-binding protein [Nocardioides sp. JS614]
 gi|119536915|gb|ABL81532.1| extracellular solute-binding protein, family 1 [Nocardioides sp.
           JS614]
          Length = 333

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 75/165 (45%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKI----SPIYTSSIQRPPITQGSPVDVIITKDETS 84
           L +Y  Q++ +M  +  +F + TG+ +          S Q     + SP DV +T++  +
Sbjct: 28  LVIYNAQHEELMTDVAKAFTDETGIDVELRNGKDLEMSAQLVAEGKASPADVFLTENSPA 87

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +A   N  L  +LP   +     + +  +         + VL Y+T ++   +LP S+ D
Sbjct: 88  MAQVENAGLFTELPQDAVAPIPAMYRPRSGLWTGFVARSTVLVYNTDQVSADELPDSILD 147

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L + +WK R+S +P    F  ++  +     +   + +++ I AN
Sbjct: 148 LADPEWKGRISFSPTGADFQAIVAAVLDLEGEQKTRAWLEGIKAN 192


>gi|86359635|ref|YP_471527.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
 gi|86283737|gb|ABC92800.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
          Length = 340

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 8/199 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F R +     LL     A S     + L +Y  Q++S+    I +F + TG+K++     
Sbjct: 8   FSRVLTLAASLLSATALAGSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGG 67

Query: 62  SIQ--RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
            +Q     I +G  SP DV +T++  ++ L     L   +    + +     +  +    
Sbjct: 68  DMQFANQIIQEGDASPADVFLTENSPAMTLVDGAGLFAPVEKETLDQVPEQYRPADGMWT 127

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            I+  T V AY   ++    LPKS+ DL +  WK R   AP    F  ++  + Q   + 
Sbjct: 128 GIAARTTVFAYDKTKLSEDKLPKSLLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGED 187

Query: 176 VVQDFIKNITANEILTKYK 194
             + ++K +  N   T YK
Sbjct: 188 ATKAWLKGLKDN--ATPYK 204


>gi|157370774|ref|YP_001478763.1| extracellular solute-binding protein [Serratia proteamaculans 568]
 gi|157322538|gb|ABV41635.1| extracellular solute-binding protein family 1 [Serratia
           proteamaculans 568]
          Length = 338

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 92/192 (47%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTTK--YLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AFS    ++   + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMMLAFSANAASQDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  S+ L  N  L   L A  + +     + ++ + + I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDAATLAQVEPQYRPQHGRWIGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+  ++  A LPKS+ DL   +WK R + +P+   F  +++ + +   +    +++K
Sbjct: 133 VFVYNPAKLTEAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLEWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|22125423|ref|NP_668846.1| iron(III)-binding periplasmic protein [Yersinia pestis KIM 10]
 gi|45442361|ref|NP_993900.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108808142|ref|YP_652058.1| iron(III)-binding periplasmic protein [Yersinia pestis Antiqua]
 gi|108811586|ref|YP_647353.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|145599342|ref|YP_001163418.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides F]
 gi|149365176|ref|ZP_01887211.1| iron(III)-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|162419376|ref|YP_001607110.1| iron(III)-binding periplasmic protein [Yersinia pestis Angola]
 gi|165926936|ref|ZP_02222768.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939210|ref|ZP_02227760.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011140|ref|ZP_02232038.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212263|ref|ZP_02238298.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398365|ref|ZP_02303889.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421149|ref|ZP_02312902.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424455|ref|ZP_02316208.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467878|ref|ZP_02332582.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis FV-1]
 gi|167468492|ref|ZP_02333196.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis FV-1]
 gi|218930008|ref|YP_002347883.1| iron(III)-binding periplasmic protein [Yersinia pestis CO92]
 gi|229838546|ref|ZP_04458705.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229895612|ref|ZP_04510783.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides A]
 gi|229899111|ref|ZP_04514254.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901862|ref|ZP_04516983.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|270490046|ref|ZP_06207120.1| bacterial extracellular solute-binding protein [Yersinia pestis KIM
           D27]
 gi|294504715|ref|YP_003568777.1| iron(III)-binding periplasmic protein [Yersinia pestis Z176003]
 gi|21958311|gb|AAM85097.1|AE013755_6 solute-binding periplasmic protein for iron ABC transporter
           [Yersinia pestis KIM 10]
 gi|45437225|gb|AAS62777.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108775234|gb|ABG17753.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|108780055|gb|ABG14113.1| iron(III)-binding periplasmic protein [Yersinia pestis Antiqua]
 gi|115348619|emb|CAL21563.1| iron(III)-binding periplasmic protein [Yersinia pestis CO92]
 gi|145211038|gb|ABP40445.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides F]
 gi|149291589|gb|EDM41663.1| iron(III)-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|162352191|gb|ABX86139.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis Angola]
 gi|165912810|gb|EDR31437.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921287|gb|EDR38511.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989818|gb|EDR42119.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206194|gb|EDR50674.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960638|gb|EDR56659.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050869|gb|EDR62277.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056337|gb|EDR66106.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229680758|gb|EEO76853.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|229687513|gb|EEO79586.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229694912|gb|EEO84959.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701418|gb|EEO89446.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides A]
 gi|262362777|gb|ACY59498.1| iron(III)-binding periplasmic protein [Yersinia pestis D106004]
 gi|262366702|gb|ACY63259.1| iron(III)-binding periplasmic protein [Yersinia pestis D182038]
 gi|270338550|gb|EFA49327.1| bacterial extracellular solute-binding protein [Yersinia pestis KIM
           D27]
 gi|294355174|gb|ADE65515.1| iron(III)-binding periplasmic protein [Yersinia pestis Z176003]
 gi|320014491|gb|ADV98062.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 339

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 87/190 (45%), Gaps = 11/190 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPI 68
           +L      A S E+    + +Y  Q++S        F + TG+K++      S +    I
Sbjct: 18  ILFASSANAASDEDG---IIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLI 74

Query: 69  TQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + V 
Sbjct: 75  QEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEDGRWTGIAARSTVF 134

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            Y+  +I  A+LPKS+ DL   +WK R + +P+   F  +++ M     +    +++K +
Sbjct: 135 VYNPAKISEAELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLEWLKAM 194

Query: 185 TANEILTKYK 194
             N   T YK
Sbjct: 195 KTN--ATAYK 202


>gi|227327906|ref|ZP_03831930.1| iron(III)-binding periplasmic protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 338

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 83/172 (48%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++    S   +    + +G  SP DV +T++  S
Sbjct: 33  IVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDTELGNQLVQEGKSSPADVFLTENSPS 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N DL   L    + +     +  + + + I+  + V  Y+  +   A LPKS+ D
Sbjct: 93  MVLVDNADLFAPLDKDTLAQVPSDYRPSHGRWIGIAARSTVFVYNPTKFTDAQLPKSLAD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++   +   +   Q+++K +  N   T YK
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSAYLELKGEKATQEWLKGMKEN--FTAYK 202


>gi|77456759|ref|YP_346264.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77380762|gb|ABA72275.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 336

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 77/166 (46%), Gaps = 10/166 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           LTLY  Q++ V   I  +FE +TG+ ++    SS Q     I +G  SP DVI T  E S
Sbjct: 33  LTLYNGQHKEVGDAIAKAFEAKTGIHVNVRKGSSNQLASQIIEEGDRSPADVIYT--EES 90

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNE----NKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
             LN      L A        VL  E    N   + ++   +V+A++ K I   DLPKSV
Sbjct: 91  PPLNNLGEQGLLAKADDATLAVLPKEYVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSV 150

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
            D  + QW+ ++   P + +F      + +   +   ++++  + A
Sbjct: 151 LDFADPQWQGKVGFVPTSGAFQEQAVAIIKKHGREAAEEWLTGLRA 196


>gi|229588083|ref|YP_002870202.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           SBW25]
 gi|229359949|emb|CAY46803.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           SBW25]
          Length = 341

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 8/174 (4%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPV 74
           A+S +  +  LTLY  Q++ V   +  +FE +TG+ ++    SS Q     + +G  SP 
Sbjct: 30  AYSADKVS--LTLYNGQHKEVGDELAKAFEAKTGIHVNVRKGSSNQLASQVVEEGDRSPA 87

Query: 75  DVIITKDETSL-ALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DVI T++   L  L E  LL K+ A  +          +   M ++  T+V+A++ K I 
Sbjct: 88  DVIYTEESPPLNKLGEQGLLAKIDASTLDVLPKDYVGAHGDWMGVTARTRVVAFNPKLIA 147

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
             DLPKSV D    +W+ ++   P + +F      + +   +   ++++  + A
Sbjct: 148 EKDLPKSVLDFAGPEWQGKVGFVPTSGAFQEQAVAIIKLHGREAAEEWLTGLRA 201


>gi|170723832|ref|YP_001751520.1| extracellular solute-binding protein [Pseudomonas putida W619]
 gi|169761835|gb|ACA75151.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           W619]
          Length = 337

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 90/198 (45%), Gaps = 25/198 (12%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A + +  T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAAVLSLVMGAPAAMADDPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQRPP--ITQG--SPVDVIITKDE----------TSLALNEDLLHKLPAHLIKKNSFVLK 108
            Q     I +G  SP D+I T++               +++  L+ LP   +  N     
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMLPKEYVAANG---- 123

Query: 109 NENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
                 M ++  T+V+ ++ K+I   DLP+SV D  N +W  ++   P + +F      +
Sbjct: 124 ----SWMGVTARTRVVVFNPKKIDEKDLPQSVMDFANPEWDGKVGFVPTSGAFQEQAVAI 179

Query: 169 EQTPNKTVVQDFIKNITA 186
            +   +   ++++  + A
Sbjct: 180 LKMHGRDAAEEWLTGLKA 197


>gi|325528370|gb|EGD05516.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. TJI49]
          Length = 335

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 8/183 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPI 68
           L+L G   A      T  LTLY  Q++ V+  ++  FE ++G  VK+      ++    +
Sbjct: 12  LMLTGALTAMPARAAT--LTLYNAQHEQVVNQLVKDFEAQSGITVKVRSGEGPALAAQLV 69

Query: 69  TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
           T+G  +P DV  T++   L L  ++ LL K  A  ++         +   + +     VL
Sbjct: 70  TEGDRTPADVYFTENSPELVLLDHKGLLAKTDAATLQAVPARYNPADGNWVGVLARENVL 129

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            Y+T +++   LP S+ DL   +WK ++ IAP++  F  +++ +     +     ++K +
Sbjct: 130 VYNTAKLQPQQLPASLLDLAKPEWKGKVGIAPSDADFLPVVSAVLALHGEAATLQWLKGL 189

Query: 185 TAN 187
             N
Sbjct: 190 KTN 192


>gi|116669173|ref|YP_830106.1| extracellular solute-binding protein [Arthrobacter sp. FB24]
 gi|116609282|gb|ABK02006.1| extracellular solute-binding protein, family 1 [Arthrobacter sp.
           FB24]
          Length = 351

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 78/165 (47%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           +T+Y  Q++S+    + +F   TGVK++    S  +     I +G  SP DV +T++  +
Sbjct: 46  ITVYNAQHESLTKEWVDAFTAETGVKVTLRQGSDTEMSNQIIQEGAASPADVFLTENSPA 105

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +A   N  L   +    I +     +    K   I+  + VL Y   ++    LPKS+ D
Sbjct: 106 MAQVENAGLFADVDKATIDQVPAEYRPSTGKWTGIAARSTVLVYDKAKLSEDQLPKSMLD 165

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   +WK + + +P+   F  +++ + +   +   ++++K +  N
Sbjct: 166 LAKPEWKGKWAASPSGADFQAIVSALLELKGEAAAEEWLKGMKEN 210


>gi|222107061|ref|YP_002547852.1| ABC transporter substrate binding protein (iron) [Agrobacterium
           vitis S4]
 gi|221738240|gb|ACM39136.1| ABC transporter substrate binding protein (iron) [Agrobacterium
           vitis S4]
          Length = 329

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 86/194 (44%), Gaps = 8/194 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            + + L        AF+ +     + +Y  Q++S+    + +F ++TG+K++    S +Q
Sbjct: 2   AVLSALFATTAIVPAFAADGDG--IVVYNAQHESLGREWVEAFTKQTGIKVTMRQGSDMQ 59

Query: 65  RP----PITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                    + SP DV +T++  ++ L     L   + A  + +     +  N + + I+
Sbjct: 60  FANQLLQEGEASPADVFLTENSPAMTLVDQAGLFAPVDADTLAQVPEEFRPANGQWIGIA 119

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V AY   ++    LPKS+ DL +  WK R + +P+   F  +++ + +   +    
Sbjct: 120 ARSTVFAYDKTKLSEDKLPKSLLDLADPAWKGRWAASPSGADFQAIVSALLELKGEEATA 179

Query: 179 DFIKNITANEILTK 192
            ++K +  N    K
Sbjct: 180 KWLKALKENATFYK 193


>gi|84495089|ref|ZP_00994208.1| iron-binding periplasmic protein; sfuA protein precursor
           [Janibacter sp. HTCC2649]
 gi|84384582|gb|EAQ00462.1| iron-binding periplasmic protein; sfuA protein precursor
           [Janibacter sp. HTCC2649]
          Length = 371

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 73/147 (49%), Gaps = 8/147 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG--SPVDVIITKDET 83
           +T+Y  Q++ +    + +F + TGVK++ I   S   +    + +G  SP DV +T++  
Sbjct: 66  ITVYNAQHEELSQAWVDAFTKETGVKVT-IRNGSDTELSNQIVAEGKASPADVFLTENSP 124

Query: 84  SLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           ++A   N DL   +    +++     +    K   I+  + VL Y  +++K  +LPKS+ 
Sbjct: 125 AMAQVENADLFADVDKATLEQVPSQFRPSTAKWTGIAARSTVLVYDKRKVKEDELPKSML 184

Query: 142 DLTNAQWKKRLSIAPNNISFHRLLNTM 168
           DL   +WK R + +P    F  ++  +
Sbjct: 185 DLAKPEWKGRWAASPTGADFQAIVAAL 211


>gi|222084389|ref|YP_002542918.1| iron(III) ABC transporter [Agrobacterium radiobacter K84]
 gi|221721837|gb|ACM24993.1| iron(III) ABC transporter [Agrobacterium radiobacter K84]
          Length = 338

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 85/183 (46%), Gaps = 24/183 (13%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKD 81
           ++ + +Y  Q++++       F + TG+K++    S +Q     + +G  SP DV +T++
Sbjct: 30  SEGIVVYNAQHETLTQAWADGFTKETGIKVTIRNGSDMQFANQIVEEGAASPADVYLTEN 89

Query: 82  ETSLAL----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
              + L          + D L ++P +         K  +   + ++  + V AY   ++
Sbjct: 90  SPGMTLVDANKLFAPVDADTLAQVPENF--------KAVDGNWVGVAARSTVFAYDKTKL 141

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILT 191
           K ADLPKS+ DL + +WK R   +P    F  +++ + +   +   + ++K +  N   T
Sbjct: 142 KEADLPKSLLDLADPKWKGRWGASPAGADFQAIVSALLELKGEDATKSWLKAMKEN--AT 199

Query: 192 KYK 194
            YK
Sbjct: 200 PYK 202


>gi|241206796|ref|YP_002977892.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860686|gb|ACS58353.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 338

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 8/180 (4%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDV 76
           S +   + L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP DV
Sbjct: 25  SAQAQDEGLVVYNAQHESLGREWIDAFSKETGIKVTMRQGSDMQFANQIIQEGDASPADV 84

Query: 77  IITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
            +T++  ++ L     L   +    + +     +  +     I+  T V AY   ++   
Sbjct: 85  FLTENSPAMTLVDGAGLFAPIEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTED 144

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
            LPKS+ DL +  WK R   AP    F  ++  + Q   +   + ++K +  N   T YK
Sbjct: 145 KLPKSMLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGEDATKAWLKGLKDN--ATPYK 202


>gi|218516574|ref|ZP_03513414.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli 8C-3]
          Length = 344

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKDETS 84
           L +Y  Q++S+    I +F + TG+K++      +Q     I +G  SP DV +T++  +
Sbjct: 39  LVVYNAQHESLGREWIDAFTKETGIKVTMRQGGDMQFANQIIQEGDASPADVFLTENSPA 98

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +AL     L   +    + +     +  +     I+  T V AY   ++    LPKS+ D
Sbjct: 99  MALVDGAGLFAPVEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTEDKLPKSLLD 158

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L +  WK R   AP    F  ++ ++ Q   +   + ++K +  N   T YK
Sbjct: 159 LADPAWKGRWGAAPAGADFQAIVASLLQLKGEDATKAWLKGLKDN--ATPYK 208


>gi|190893908|ref|YP_001980450.1| iron(III) ABC transporter substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190699187|gb|ACE93272.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 652]
          Length = 344

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKDETS 84
           L +Y  Q++S+    I +F + TG+K++      +Q     I +G  SP DV +T++  +
Sbjct: 39  LVVYNAQHESLGREWIDAFTKETGIKVTMRQGGDMQFANQIIQEGDASPADVFLTENSPA 98

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +AL     L   +    + +     +  +     I+  T V AY   ++    LPKS+ D
Sbjct: 99  MALVDGAGLFAPVEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTEDKLPKSLLD 158

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L +  WK R   AP    F  ++ ++ Q   +   + ++K +  N   T YK
Sbjct: 159 LADPAWKGRWGAAPAGADFQAIVASLLQLKGEDATKAWLKGLKDN--ATPYK 208


>gi|242239853|ref|YP_002988034.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech703]
 gi|242131910|gb|ACS86212.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech703]
          Length = 338

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 82/163 (50%), Gaps = 8/163 (4%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           L+ GF+   + +     + +Y  Q+++++     +F + TG+K++      S +    + 
Sbjct: 18  LMLGFS--CNAQAEADGIVVYNAQHENLVKSWADAFTQETGIKVTLRNGGDSELGNQLVQ 75

Query: 70  QGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +GS  P DV +T++  ++ L  N  L   + A  +++     +  + + + I+  + V  
Sbjct: 76  EGSATPADVFLTENSPAMVLVDNAHLFAPVDAETLQQVEPQYRPSHGRWIGIAARSTVFV 135

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
           Y+ ++I  A LPKS+ DL   +WK R + +P+   F  +++ M
Sbjct: 136 YNPEKISEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAM 178


>gi|51597001|ref|YP_071192.1| ABC transporter, periplasmic iron(III)-binding protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|153950683|ref|YP_001400329.1| iron ABC transporter permease [Yersinia pseudotuberculosis IP
           31758]
 gi|186896083|ref|YP_001873195.1| extracellular solute-binding protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|51590283|emb|CAH21920.1| ABC transporter, periplasmic iron(III)-binding protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|152962178|gb|ABS49639.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|186699109|gb|ACC89738.1| extracellular solute-binding protein family 1 [Yersinia
           pseudotuberculosis PB1/+]
          Length = 339

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 87/190 (45%), Gaps = 11/190 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPI 68
           +L      A S E+    + +Y  Q++S        F + TG+K++      S +    I
Sbjct: 18  ILFASSANAASDEDG---IIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLI 74

Query: 69  TQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+  + V 
Sbjct: 75  QEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEDGRWTGIAARSTVF 134

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            Y+  +I  ++LPKS+ DL   +WK R + +P+   F  +++ M     +    +++K +
Sbjct: 135 VYNPAKISESELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLEWLKAM 194

Query: 185 TANEILTKYK 194
             N   T YK
Sbjct: 195 KTN--ATAYK 202


>gi|325962067|ref|YP_004239973.1| ABC-type Fe3+ transporter, periplasmic component [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468154|gb|ADX71839.1| ABC-type Fe3+ transport system, periplasmic component [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 350

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 79/165 (47%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           +T+Y  Q++S+    I +F   TG+K++    S   +    I +G  SP DV +T++  +
Sbjct: 45  ITVYNAQHESLTKEWIDAFTAETGIKVTMRQGSDTELSNQIIQEGDASPADVFLTENSPA 104

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +    N  L   + A  +++     +    K   I+  + VL Y   ++    LPKS+ D
Sbjct: 105 MTQVENAGLFADVDAATLEQVPAEFRPSTGKWTGIAARSTVLVYDKNKLTEDQLPKSMLD 164

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   +WK + + +P+   F  +++ + +   +   ++++K +  N
Sbjct: 165 LAKPEWKGKWAASPSGADFQAIVSALLELKGEAATEEWLKGMKDN 209


>gi|238755861|ref|ZP_04617191.1| Iron(III)-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
 gi|238705946|gb|EEP98333.1| Iron(III)-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
          Length = 338

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 94/202 (46%), Gaps = 18/202 (8%)

Query: 5   TIYTYLLLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKI--SPIYT 60
           ++ +  LL      AFS    +  + + +Y  Q+++++   +  F + TG+K+       
Sbjct: 7   SLGSIALLASSMMLAFSVNAASNDESIVVYNAQHENLVKSWVDGFTKDTGIKVILRNGGD 66

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLP----AHLIKKNSFVLKNENK 112
           S +    I +G  SP DV +T++  ++ L  N  L   L     A + KK     + E+ 
Sbjct: 67  SELGNQLIQEGNASPADVFLTENSPAMVLVDNAKLFAPLDTATQAQVAKK----YQPEHG 122

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
           +   I+  + V  Y+ ++I  A LPKS+ DL    WK R + +P+   F  +++ M +  
Sbjct: 123 RWTGIAARSTVFVYNPEKISEAQLPKSIMDLAKPDWKGRWAASPSGADFQAIVSAMLELK 182

Query: 173 NKTVVQDFIKNITANEILTKYK 194
            +    +++K +  N   T YK
Sbjct: 183 GEKATLEWLKAMKRN--FTAYK 202


>gi|104783864|ref|YP_610362.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           entomophila L48]
 gi|95112851|emb|CAK17579.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas entomophila L48]
          Length = 337

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 13/192 (6%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   LL L+ G   A + E  T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAALLSLVIGAPAALADEPVT--LTMYNGQHKEIGDAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQRPP--ITQG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNE----NKKL 114
            Q     I +G  SP D+I T  E S  LN      L A +    + ++  E    N   
Sbjct: 68  NQLASQIIEEGERSPADIIYT--EESPPLNNLGELGLLAKIDDATANMMPKEYVGANGTW 125

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           M I+  T+++ ++ K+I   DLP +V D  N +W+ R+   P + +F      + +   +
Sbjct: 126 MGITARTRIVVFNPKKIDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAILKMHGR 185

Query: 175 TVVQDFIKNITA 186
              ++++  + A
Sbjct: 186 EATEEWLTGLKA 197


>gi|220911513|ref|YP_002486822.1| extracellular solute-binding protein family 1 [Arthrobacter
           chlorophenolicus A6]
 gi|219858391|gb|ACL38733.1| extracellular solute-binding protein family 1 [Arthrobacter
           chlorophenolicus A6]
          Length = 352

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS----SIQRPPITQGSPVDVIITKDETS 84
           +T+Y  Q++S+    + +F   TG+K++    S    S Q     Q SP DV +T++  +
Sbjct: 47  ITVYNAQHESLTKEWVDAFTSETGIKVTMRQGSDTELSNQIIQEGQASPADVFLTENSPA 106

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +    N DL   +    +++     +    K   I+  + VL Y   +I    LPKS+ D
Sbjct: 107 MTQVENADLFADVDKATLEQVPTEFQPSTGKWTGIAARSTVLVYDKAKISEDQLPKSMLD 166

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   +WK + + +P    F  +++ + +   +   +++++ +  N
Sbjct: 167 LAKPEWKGKWAASPTGADFQAIVSALLELKGEDATEEWLQGMKEN 211


>gi|325271220|ref|ZP_08137765.1| extracellular solute-binding protein [Pseudomonas sp. TJI-51]
 gi|324103623|gb|EGC00925.1| extracellular solute-binding protein [Pseudomonas sp. TJI-51]
          Length = 337

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 88/198 (44%), Gaps = 25/198 (12%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQRPP--ITQG--SPVDVIITKDE----------TSLALNEDLLHKLPAHLIKKNSFVLK 108
            Q     I +G  SP D+I T++               +++  L+ LP   +  N     
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMLPKEYVAANG---- 123

Query: 109 NENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
                 M ++  T+V+ Y+ K+I   DLP +V D  N  W+ R+   P + +F      +
Sbjct: 124 ----TWMGVTARTRVVVYNPKKIDEKDLPTTVMDFANPDWEGRVGYVPTSGAFQEQAVAI 179

Query: 169 EQTPNKTVVQDFIKNITA 186
            +   +   ++++  + A
Sbjct: 180 LKMHGREATEEWLTGLKA 197


>gi|270261997|ref|ZP_06190269.1| iron(III)-binding periplasmic protein, precursor [Serratia
           odorifera 4Rx13]
 gi|270043873|gb|EFA16965.1| iron(III)-binding periplasmic protein, precursor [Serratia
           odorifera 4Rx13]
          Length = 338

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 85/172 (49%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T++  +
Sbjct: 33  IVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPA 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   L A  + +     + ++ + + I+  + V  Y+  ++  A LPKS+ D
Sbjct: 93  MVLVDNAKLFAPLDAATLAQVEPQYRPQHGRWIGIAARSTVFVYNPAKLTEAQLPKSLLD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++ + +   +    +++K +  N   T YK
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLEWLKAMKTN--FTAYK 202


>gi|26991560|ref|NP_746985.1| iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|148549963|ref|YP_001270065.1| extracellular solute-binding protein [Pseudomonas putida F1]
 gi|24986646|gb|AAN70449.1|AE016686_3 iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|148514021|gb|ABQ80881.1| extracellular solute-binding protein, family 1 [Pseudomonas putida
           F1]
 gi|313500864|gb|ADR62230.1| Iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida BIRD-1]
          Length = 337

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 88/198 (44%), Gaps = 25/198 (12%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    T  LT+Y  Q++ +   I  ++E +TG+ I     SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHIDIRKGSS 67

Query: 63  IQRPP--ITQG--SPVDVIITKDE----------TSLALNEDLLHKLPAHLIKKNSFVLK 108
            Q     I +G  SP D+I T++               +++  L+ +P   +  N     
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMMPKEYVGANG---- 123

Query: 109 NENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
                 M I+  T+++ Y+ K++   DLP +V D  N +W+ R+   P + +F      +
Sbjct: 124 ----TWMGITARTRIVVYNPKKVDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAI 179

Query: 169 EQTPNKTVVQDFIKNITA 186
            +   +   ++++  + A
Sbjct: 180 LKMHGREATEEWLTGLKA 197


>gi|134455|sp|P21408|FBPA_SERMA RecName: Full=Fe(3+)-binding periplasmic protein; AltName:
           Full=Iron(III)-binding periplasmic protein; Flags:
           Precursor
 gi|152860|gb|AAA26573.1| iron transport protein (sufA) precursor [Serratia marcescens]
          Length = 338

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 90/192 (46%), Gaps = 10/192 (5%)

Query: 11  LLLCGFTEAFSTENTT--KYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRP 66
           LL      AF  +  +  + + +Y  Q+++++   +  F + TG+K++      S +   
Sbjct: 13  LLASSMMLAFGAQAASADQGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQ 72

Query: 67  PITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            + +GS  P DV +T++  ++ L  N  L   L A  + +     +  + + + I+  + 
Sbjct: 73  LVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARST 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V  Y+  ++  A LPKS+ DL   +WK R + +P+   F  +++ + +   +     ++K
Sbjct: 133 VFVYNPAKLSDAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLK 192

Query: 183 NITANEILTKYK 194
            +  N   T YK
Sbjct: 193 AMKTN--FTAYK 202


>gi|209551354|ref|YP_002283271.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537110|gb|ACI57045.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 340

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 86/207 (41%), Gaps = 24/207 (11%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F + +      L     A S     + L +Y  Q++S+    I +F + TG+K++     
Sbjct: 8   FSQALALAASFLSATALAGSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGG 67

Query: 62  SIQ--RPPITQG--SPVDVIITKDETSLAL----------NEDLLHKLPAHLIKKNSFVL 107
            +Q     I +G  SP DV +T++  ++ L           +D L ++P           
Sbjct: 68  DMQFANQIIQEGDASPADVFLTENSPAMTLVDGAGLFAPIEKDTLDQVPDQY-------- 119

Query: 108 KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNT 167
           +  +     I+  T V AY   ++    LPKS+ DL +  WK R   AP    F  ++ +
Sbjct: 120 RPSDGMWTGIAARTTVFAYDKTKLTEDKLPKSMLDLADPAWKGRWGAAPAGADFQAIVAS 179

Query: 168 MEQTPNKTVVQDFIKNITANEILTKYK 194
           + Q   +   + ++K +  N   T YK
Sbjct: 180 LLQLKGEDATKAWLKGLKDNA--TPYK 204


>gi|258593641|emb|CBE69982.1| Iron(III) ABC transporter iron (III)-binding protein [NC10
           bacterium 'Dutch sediment']
          Length = 334

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 89/195 (45%), Gaps = 28/195 (14%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSI 63
           +   LL +C    A ++E     L +Y+ + +S + P++  FE  TG+K++     TS +
Sbjct: 14  VLATLLFVCVDASASASE-----LVIYSGRKESAIKPVVDLFERETGIKVALKVGKTSGL 68

Query: 64  --------QRPPITQGSPVDVIITKDE--TSLALNEDLLHKLPAHLIKKNSFVLKNENKK 113
                   QRP        D++I  +     + + E LL    +   +      K+    
Sbjct: 69  ANEILQERQRPR------ADILIATEAGICEILVREGLLEPYVSPGARAIPAEHKSSRGL 122

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNN----ISF-HRLLNTM 168
              IS   +V+ Y+T  +K  D+P SV DLT+A+WK +++IA       +S+   L+  M
Sbjct: 123 WTGISGRARVIIYNTDLVKGGDIPNSVLDLTDAKWKGKIAIAGTRERTTLSWLSALVQVM 182

Query: 169 EQTPNKTVVQDFIKN 183
            +   KT +   ++N
Sbjct: 183 SEAKAKTYIDKLMEN 197


>gi|218681415|ref|ZP_03529312.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 894]
          Length = 338

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 79/180 (43%), Gaps = 24/180 (13%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKDETS 84
           L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP DV +T++  +
Sbjct: 33  LVVYNAQHESLGREWIDAFTKETGIKVTMRQGSDMQFANQIIQEGDASPADVFLTENSPA 92

Query: 85  LAL----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           + L           +D L ++P           +  +     I+  T V AY   ++   
Sbjct: 93  MTLVDGAGLFAPVEKDTLDQVPEQY--------RPADGMWTGIAARTTVFAYDKTKLSED 144

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
            LPKS+ DL +  WK R   +P    F  ++  + Q   +   + ++K +  N   T YK
Sbjct: 145 KLPKSLLDLADPAWKGRWGASPAGADFQAIVAALLQLKGEDATKAWLKGLKDN--ATPYK 202


>gi|61679631|pdb|1XVY|A Chain A, Crystal Structure Of Iron-Free Serratia Marcescens Sfua
          Length = 309

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 83/172 (48%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQGS--PVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T++  +
Sbjct: 4   IVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTENSPA 63

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   L A  + +     +  + + + I+  + V  Y+  ++  A LPKS+ D
Sbjct: 64  MVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPAKLSDAQLPKSLLD 123

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++ + +   +     ++K +  N   T YK
Sbjct: 124 LAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLKAMKTN--FTAYK 173


>gi|182441092|dbj|BAG24189.1| iron ABC transporter, periplasmic iron-binding protein [Thermus
           thermophilus]
          Length = 328

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPVDVIITKDETS 84
           LT+Y+ + QS++ P++  FE  TG+++   Y++  Q     Q     SP DV+      +
Sbjct: 24  LTIYSGRGQSLVEPLVKRFEAETGIRVQVRYSTDAQILAALQEEGNRSPADVLWLNTSGA 83

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A  + LL  L   L+ K  +FV    +K  + ++   +VLAY+  ++K  +LP+S+ 
Sbjct: 84  LGQAAAKGLLRPLGESLLGKPLAFV--PGSKAWVPVTMRLRVLAYNPNKVKAEELPQSLL 141

Query: 142 DLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           DL     +K L +                TP  +  QD +  I A
Sbjct: 142 DLPRFAQEKGLRVG--------------WTPTYSSFQDMVAGILA 172


>gi|70734078|ref|YP_257718.1| iron(III) ABC transporter periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68348377|gb|AAY95983.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 341

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 78/166 (46%), Gaps = 10/166 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           LTLY  Q++ V   +  +FE +TG+ ++    SS Q     + +G  SP DVI T  E S
Sbjct: 38  LTLYNGQHKEVGDAVAKAFEAKTGIHVNVRKGSSNQLASQVVEEGDRSPADVIYT--EES 95

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNE----NKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
             LN+     L A        VL  E    N   + ++   +V+A++ K I   DLPKSV
Sbjct: 96  PPLNKLGEQGLLAQTDTTTLAVLPKEYVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSV 155

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
            + +  QW+ ++   P + +F      + +   +   ++++  + A
Sbjct: 156 MEFSQPQWQGKVGFVPTSGAFQEQAVAIIKMHGRDAAEEWLTGLRA 201


>gi|227112821|ref|ZP_03826477.1| iron(III)-binding periplasmic protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 338

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 82/172 (47%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           + +Y  Q+++++   +  F + TG+K++    S   +    + +G  SP DV +T++  S
Sbjct: 33  IVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDTELGNQLVQEGKSSPADVFLTENSPS 92

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N +L   L    + +     +  + + + I+  + V  Y+  +   A LPKS+ D
Sbjct: 93  MVLVDNANLFAPLDNATLAQVPSDYRPSHGRWIGIAARSTVFVYNPTKFTDAQLPKSLAD 152

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L   +WK R + +P+   F  +++   +   +   Q ++K +  N   T YK
Sbjct: 153 LAKPEWKGRWAASPSGADFQAIVSAYLELKGEQATQAWLKGMKEN--FTAYK 202


>gi|116254310|ref|YP_770148.1| iron(III)-binding periplasmic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258958|emb|CAK10067.1| putative iron(III)-binding periplasmic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 340

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 76/172 (44%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKDETS 84
           L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP D+ +T++  +
Sbjct: 35  LVVYNAQHESLGREWIAAFTKETGIKVTMRQGSDMQFANQIIQEGDASPADIFLTENSPA 94

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L     L   +    + +     +  +     I+  T V  Y   ++    LPKS+ D
Sbjct: 95  MTLVDGAGLFAPIEKETLDQVPEQYRPADGMWTGIAARTTVFVYDKTKLTEDKLPKSMLD 154

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L +  WK R   AP    F  ++  + Q   +    D++K +  N   T YK
Sbjct: 155 LADPAWKGRWGAAPAGADFQAIVAALLQLKGEQSTADWLKALKEN--ATPYK 204


>gi|320451372|ref|YP_004203468.1| iron(III)-binding protein [Thermus scotoductus SA-01]
 gi|320151541|gb|ADW22919.1| iron(III)-binding protein [Thermus scotoductus SA-01]
          Length = 331

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 83/170 (48%), Gaps = 16/170 (9%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPIT 69
           L+ L      F+ + T   LTLY+ + QS++ P++  F+  TG+++   Y +  Q     
Sbjct: 9   LIGLAALGLVFAQQQT---LTLYSGRGQSLVEPLVKQFQAETGIRVQVRYGTDAQILAAL 65

Query: 70  QG----SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQ 122
           Q     SP DV       +L  A ++ LL  L   L+++  +FV    +K  + ++   +
Sbjct: 66  QEEGSRSPADVFWANTAGALGQAASKGLLRPLGDTLLRQPVAFV--PASKAWVPVTLRLR 123

Query: 123 VLAYSTKRIKIADLPKSVFDLTN-AQWK---KRLSIAPNNISFHRLLNTM 168
           VLAY+ +++K  +LP S+ DL   AQ K    R+   P   SF  ++  M
Sbjct: 124 VLAYNPQKLKPEELPASILDLPRFAQEKGLAGRVGWTPTYSSFQDMVAGM 173


>gi|110835458|ref|YP_694317.1| iron ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
 gi|110648569|emb|CAL18045.1| iron ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
          Length = 341

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 91/185 (49%), Gaps = 17/185 (9%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQRP 66
           L G +E  + E     L +YT +N  ++ P+  ++ E TGV+I      +   T+ +Q  
Sbjct: 22  LWGCSEPAADEE----LVVYTSRNDHLIKPVFDAYTEATGVRIRYITDNAAALTARLQAE 77

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQV 123
              + SP D++IT D  +L  A  + LL  + + ++  N    L +  K+   ++   + 
Sbjct: 78  --GERSPADMLITVDAGNLWNAAEKGLLSPVESEVLSNNVPAALTDPKKQWYGLTVRART 135

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIK 182
           L YS  RI+ ++L  +  +L + QWK RL +  +   +++ L+ TM +   K   ++ ++
Sbjct: 136 LVYSRDRIQPSEL-STYENLADPQWKGRLCLRTSKKVYNQSLVATMIERQGKEKTEEIVR 194

Query: 183 NITAN 187
              AN
Sbjct: 195 GWVAN 199


>gi|77459062|ref|YP_348568.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77383065|gb|ABA74578.1| iron(III)-binding periplasmic protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 337

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 79/172 (45%), Gaps = 8/172 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           L +Y  Q++++    +  F E TG+ ++       +     + +G  SP DV +T++  +
Sbjct: 32  LVVYNAQHETLTKAWVAGFTEETGIPVTVRNGDDTEMGNQIVQEGAASPADVFLTENSPA 91

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           + L  N  L   +    +++     +  + + + I+  + V  Y+  ++   DLPKS+ D
Sbjct: 92  MVLVDNAKLFAPVAPATLEQVDAAYRPAHGQWVGIAARSTVFVYNPAKLPEKDLPKSLMD 151

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           L    WK R + +P    F  ++  + +   +    +++K + AN   T Y+
Sbjct: 152 LATPAWKGRWAASPAGADFQAIVAAVLEQKGEAATLEWLKGMKAN--FTAYR 201


>gi|145223445|ref|YP_001134123.1| extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]
 gi|145215931|gb|ABP45335.1| extracellular solute-binding protein, family 1 [Mycobacterium
           gilvum PYR-GCK]
          Length = 341

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 77/182 (42%), Gaps = 7/182 (3%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           L  G T   S+E     L +Y  Q++S+    I +F + TG+K++      + +    I 
Sbjct: 20  LAAGLTACSSSEEEDGLL-VYNAQHESLTKEWIDAFTKETGIKVTYRQGGDTELGNQLIA 78

Query: 70  QG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +G  SP DV +T++  ++A  E   L   +    I +     +    K   ++  T V A
Sbjct: 79  EGDASPADVFLTENSPAMAAVERDGLFTDVDEATIAQVPPQFRPATSKWTGVAARTTVFA 138

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           Y   ++  A LP S+ DL   +WK R    P    F  ++  M +   +     ++  + 
Sbjct: 139 YDKTKLTEAQLPTSIMDLEKPEWKGRWGAPPVKPDFQAIVAAMLELTGERATGQWLAGMK 198

Query: 186 AN 187
           A 
Sbjct: 199 AG 200


>gi|167035926|ref|YP_001671157.1| extracellular solute-binding protein [Pseudomonas putida GB-1]
 gi|166862414|gb|ABZ00822.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           GB-1]
          Length = 337

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 89/192 (46%), Gaps = 13/192 (6%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    +  LT+Y  Q++ +   I  ++E +TG+ I     SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVS--LTMYNGQHKEIGEAIAKAYEAKTGIHIDIRKGSS 67

Query: 63  IQRPP--ITQG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNE----NKKL 114
            Q     I +G  SP D+I T  E S  LN      L A +    + ++  E    N   
Sbjct: 68  NQLASQIIEEGDRSPADIIYT--EESPPLNNLGELGLLAKIDDATANMMPKEYVGANGTW 125

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           M I+  T+++ Y+ K++   DLP +V D  N +W+ R+   P + +F      + +   +
Sbjct: 126 MGITARTRIVVYNPKKVDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAILKMHGR 185

Query: 175 TVVQDFIKNITA 186
              ++++  + A
Sbjct: 186 EATEEWLTGLKA 197


>gi|78065424|ref|YP_368193.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. 383]
 gi|77966169|gb|ABB07549.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. 383]
          Length = 344

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 76/163 (46%), Gaps = 6/163 (3%)

Query: 31  LYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETSLA 86
           LY  Q++ V+  ++  FE ++G  VK+      ++    + +G  +P DV  T++   L 
Sbjct: 39  LYNAQHEQVVNQLVKDFEAQSGITVKVRSGEGPALAAQLVAEGDRTPADVYFTENSPELV 98

Query: 87  L--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
           L   + L  K  A  ++         +   + +     VL Y+T +I+   LP S+ DL 
Sbjct: 99  LLDRKGLFAKTDAATLQSVPARFNPADGNWVGVLARENVLVYNTAKIQPQQLPASLLDLA 158

Query: 145 NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +WK ++ +AP++  F  L++ +     +     ++K + AN
Sbjct: 159 KPEWKGKVGVAPSDADFLPLVSAVLALHGEAATLQWLKGLKAN 201


>gi|167841866|ref|ZP_02468550.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia thailandensis MSMB43]
          Length = 302

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 75/159 (47%), Gaps = 6/159 (3%)

Query: 35  QNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQG--SPVDVIITKDETSLAL--N 88
           Q++ V+  ++  FE +TG  VK+      ++    + +G  +P DV  T++   L L   
Sbjct: 1   QHEQVVNQLVKDFEAQTGITVKVRTGEGPALAAQLVAEGDRTPADVYFTENSPELVLLAE 60

Query: 89  EDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQW 148
           + LL K  A  +        + +   + +     VL Y+T +I+   LP S+ DL   +W
Sbjct: 61  KGLLAKTDAATLAAVPARFSSPDGDWVGVLARENVLIYNTAKIQPRQLPASLVDLAKPEW 120

Query: 149 KKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           K ++ IAP++  F  L++ M     +     ++K + AN
Sbjct: 121 KGKVGIAPSDADFLPLVSGMLALKGEAQTLQWLKGLKAN 159


>gi|289642374|ref|ZP_06474521.1| extracellular solute-binding protein family 1 [Frankia symbiont of
           Datisca glomerata]
 gi|289507806|gb|EFD28758.1| extracellular solute-binding protein family 1 [Frankia symbiont of
           Datisca glomerata]
          Length = 339

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 78/177 (44%), Gaps = 28/177 (15%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVK--ISPIYTSSI 63
           + T     CG +E  ST      +TLY  Q++ ++  ++  F   TG+K  I     S +
Sbjct: 17  VLTAAATACGGSEDAST------ITLYNAQHEDLIKVMVDGFTRETGIKVNIRSGKDSEL 70

Query: 64  QRPPITQG--SPVDVIITKDETSLAL----------NEDLLHKLPAHLIKKNSFVLKNEN 111
               + +G  SP DV +T++  +++L          ++  L ++PA  +          +
Sbjct: 71  ANQLVQEGDASPADVFVTENSPAMSLVDAHGRFVKIDDATLAQVPAQFVP--------SS 122

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
           +     +    VLAY+ +++    LP S+ DL   QW+ +  +A     F  +++ +
Sbjct: 123 RNWTGFAARATVLAYNKRQLAPDQLPASLMDLQQPQWQGKFGVAAAGADFQAIVSAV 179


>gi|218296266|ref|ZP_03497022.1| extracellular solute-binding protein family 1 [Thermus aquaticus
           Y51MC23]
 gi|218243338|gb|EED09868.1| extracellular solute-binding protein family 1 [Thermus aquaticus
           Y51MC23]
          Length = 331

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 15/178 (8%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M +RTI T    L G T    +   T+ LT+Y+ + QS++ P++  FE  TG+++   Y 
Sbjct: 1   MERRTILT----LIGLTILNLSLAQTQTLTVYSGRGQSLVEPLVKQFERDTGIRVQVRYG 56

Query: 61  SSIQRPPITQG----SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKL 114
           +  Q     Q     SP DV       +L  A    LL  L   L+K         ++  
Sbjct: 57  TDAQILAALQEEGGRSPADVFWGNTSGALGRAAELGLLRPLGDSLLKTPQ-AFAPASRSW 115

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKK----RLSIAPNNISFHRLLNTM 168
           + ++   +VLAY+ ++ K  +LP+S+ DL     +K    R+   P   SF  ++  M
Sbjct: 116 VPVTLRLRVLAYNPQKFKPEELPQSILDLPRFAREKGLGGRVGWTPTYSSFQDMVAGM 173


>gi|111020133|ref|YP_703105.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110819663|gb|ABG94947.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 80/173 (46%), Gaps = 22/173 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           +T+Y  Q++S+      +F   TG+++     S   +    + +G  SP DV +T++  +
Sbjct: 41  ITVYNAQHESLTQEWADAFTAETGIEVELRNGSDTELGNQLVAEGDQSPADVFLTENSPA 100

Query: 85  LAL----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           + L          N+D+L ++P+          +  + K   I+  + V AY+  ++   
Sbjct: 101 MTLVENAGLFADVNQDVLDQVPSQY--------RPSSGKWTGIAARSTVFAYNKDKLPQD 152

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            LPKS+ DL +  WK R + +P+   F  +++ + +   +    +++  +  N
Sbjct: 153 QLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGEDATGEWLAGMKDN 205


>gi|296139778|ref|YP_003647021.1| extracellular solute-binding protein family 1 [Tsukamurella
           paurometabola DSM 20162]
 gi|296027912|gb|ADG78682.1| extracellular solute-binding protein family 1 [Tsukamurella
           paurometabola DSM 20162]
          Length = 345

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 79/175 (45%), Gaps = 13/175 (7%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY---TSSIQRPPITQGS--PVD 75
           S  +    +TLY+ +++ ++ P+I   +    V ++  Y    + IQ     +GS  P D
Sbjct: 36  SASSAGPTITLYSGRSKELVGPLIDQIKGAVSVNVA--YDKKANQIQE----EGSRSPAD 89

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V   +D   L       LL  LP+ ++ K     ++ +      S  ++VL Y+  ++  
Sbjct: 90  VYFGQDAGELGALAKAGLLEPLPSDIVDKIPAQYRSGDGTWAATSARSRVLVYNPAQLPE 149

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           ADLP  +  L + ++K ++  AP N SF   +  +     +   + +++   ANE
Sbjct: 150 ADLPTGIDGLLDPKFKGKVGYAPTNASFKSFVTALRVLRGEDGAKAWLQGFLANE 204


>gi|119855136|ref|YP_935741.1| extracellular solute-binding protein [Mycobacterium sp. KMS]
 gi|119697854|gb|ABL94926.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           KMS]
          Length = 341

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 6/175 (3%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPV 74
           A S+      L +Y  Q++S+    I +F + TG+K++      + +    I +G  SP 
Sbjct: 26  ACSSSEEEDGLLIYNAQHESLTKEWIDAFTKETGIKVTYRQGGDTELGNQLIAEGDSSPA 85

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DV +T++  ++A  E   L   +    I +     +    K   ++  T V AY   ++ 
Sbjct: 86  DVFLTENSPAMAAVEKDGLFTDVDQATISQVPPQFRPTTSKWTGVAARTTVFAYDKTKLT 145

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            A LP+S+ DL   +WK R    P    F  ++  M +   +     ++  + AN
Sbjct: 146 EAQLPRSIMDLEKPEWKGRWGAPPVKPDFQAIVAAMLELTGEQATSAWLSAMKAN 200


>gi|55981597|ref|YP_144894.1| iron ABC transporter periplasmic iron-binding protein [Thermus
           thermophilus HB8]
 gi|55773010|dbj|BAD71451.1| iron ABC transporter, periplasmic iron-binding protein [Thermus
           thermophilus HB8]
          Length = 330

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 77/165 (46%), Gaps = 21/165 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPVDVIITKDETS 84
           LT+Y+ + QS++ P++  FE  TG+++   Y++  Q     Q     SP D+       +
Sbjct: 24  LTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGA 83

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A  + LL  L   L++K  +FV    ++  + ++   +VLAY+  RIK  +LP+S+ 
Sbjct: 84  LGQASAKGLLRPLGETLLEKPIAFV--PASRTWVPVTVRLRVLAYNPDRIKAEELPESLL 141

Query: 142 DLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           DL            P       L+  +  TP  +  QD +  + A
Sbjct: 142 DL------------PRFAREKGLVGRVGWTPTYSSFQDMVAGMIA 174


>gi|226356914|ref|YP_002786654.1| ABC transporter periplasmic protein [Deinococcus deserti VCD115]
 gi|226318904|gb|ACO46900.1| putative ABC transporter, periplasmic component [Deinococcus
           deserti VCD115]
          Length = 332

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 10/190 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           RT+     LL   T    T+ T   LT+Y+ + ++ + PI+  FE +TG+K++  Y +  
Sbjct: 3   RTVTALTALLVAGTSFAQTKGT---LTIYSGRAKTFVEPIVQQFERQTGIKVNVRYGTDA 59

Query: 64  QRPPI--TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           Q       +G  SP D+       +L    +E    KL   L +  S     +++  +  
Sbjct: 60  QLVAALREEGNRSPADIYWGNSVGALGELASEGRFSKLGTALTRTVSDDYLPDDRSWLPT 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           +   +VLAY+T +IK   LP SV DL      K R+    +  SF   L  M     +  
Sbjct: 120 TVRFRVLAYNTSKIKPDQLPDSVLDLPKMTSLKGRIGWTVSYPSFQDFLAAMIAKHGEAT 179

Query: 177 VQDFIKNITA 186
            + +I+ + A
Sbjct: 180 TRQWIEGMKA 189


>gi|325283552|ref|YP_004256093.1| extracellular solute-binding protein family 1 [Deinococcus
           proteolyticus MRP]
 gi|324315361|gb|ADY26476.1| extracellular solute-binding protein family 1 [Deinococcus
           proteolyticus MRP]
          Length = 331

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 19/172 (11%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI- 68
            L+      A S+   +  +TLY+ + ++ + PI+  FE+ TG+K++  Y    +   + 
Sbjct: 5   FLMAGALMLAGSSVAQSGSITLYSGRGKTFVEPIVQRFEKETGIKVNVRYGKDAELVALL 64

Query: 69  -TQG--SPVDVIITKDETSLA-LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT--- 121
             +G  SP DV       ++  L+ D         ++  + + +N  ++ M  S +    
Sbjct: 65  RQEGARSPADVFWGNSLGAMGQLDSD------GRFVRLGNNLSRNVARQYMPASGNWVPT 118

Query: 122 ----QVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTM 168
               + LAYS++R+K + LP SVFDL    Q+K R+    +  SF   L  M
Sbjct: 119 TVRFRTLAYSSERVKASQLPASVFDLPKMTQFKGRIGWTLSYPSFQDFLAGM 170


>gi|46199566|ref|YP_005233.1| iron(III)-binding protein [Thermus thermophilus HB27]
 gi|46197192|gb|AAS81606.1| iron(III)-binding protein [Thermus thermophilus HB27]
          Length = 330

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 76/165 (46%), Gaps = 21/165 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPVDVIITKDETS 84
           LT+Y+ + QS++ P++  FE  TG+++   Y +  Q     Q     SP D+       +
Sbjct: 24  LTIYSGRGQSLVEPLVKQFEAETGIRVQVRYGTDAQILAALQEEGSRSPADLFWANTAGA 83

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A  + LL  L   L++K  +FV    ++  + ++   +VLAY+  RIK  +LP+S+ 
Sbjct: 84  LGQASAKGLLRPLGETLLEKPIAFV--PASRTWVPVTVRLRVLAYNPDRIKAEELPESLL 141

Query: 142 DLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           DL            P       L+  +  TP  +  QD +  + A
Sbjct: 142 DL------------PRFAREKGLVGRVGWTPTYSSFQDMVAGMIA 174


>gi|260222284|emb|CBA31694.1| Fe(3+)-binding periplasmic protein [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 357

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 85/203 (41%), Gaps = 14/203 (6%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTEN--------TTKYLTLYTDQNQSVMLPIIHSFEERTG 52
           + KR     L  L     A +T          + + + +Y  Q+ S+    + +F + TG
Sbjct: 16  IMKRKFLNSLFRLAALGAAIATVGLPAQAQTPSAEGILVYNAQHASLTQAWVEAFTKETG 75

Query: 53  VKISPIYTS--SIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFV 106
           +K++    S   +    + +G  SP DV +T++  ++AL     L   L    I   +  
Sbjct: 76  IKVTLRQGSDTELGNQLVQEGAASPADVFLTENSPAMALVDGAGLFAPLDPATINLIAPS 135

Query: 107 LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLN 166
            +  + + + I+  + V  Y   +     LPKS+ DL   +WK R + +P    F  +++
Sbjct: 136 YRTAHGRWVGIAARSTVFVYKKTKFTPEQLPKSLMDLAKPEWKSRWAASPAGADFQAIVS 195

Query: 167 TMEQTPNKTVVQDFIKNITANEI 189
            + +   +     ++K +  N +
Sbjct: 196 AVLELKGEAATAAWLKGMKENVV 218


>gi|118473479|ref|YP_887939.1| ferric iron-binding periplasmic protein of ABC transporter
           [Mycobacterium smegmatis str. MC2 155]
 gi|118174766|gb|ABK75662.1| ferric iron-binding periplasmic protein of ABC transporter
           [Mycobacterium smegmatis str. MC2 155]
          Length = 349

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 77/170 (45%), Gaps = 28/170 (16%)

Query: 14  CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG 71
           CG        ++   + +Y+ ++++++ P+I  F   TG+++   Y  S +     IT+G
Sbjct: 30  CG--SGSDEADSADKIVVYSGRSENLVAPLIEKFTSDTGIEVETRYAGSGELAAQLITEG 87

Query: 72  --SPVDVIITKDETSLA----------LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
             SP DV +++D  +L           +N++ +  +PA+            +K  + +S 
Sbjct: 88  DKSPADVFLSQDAGALGAVSEAGLFAPINDEAMAAVPAN--------FSAADKSWLGVSG 139

Query: 120 DTQVLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHRLLNTM 168
             +VL Y+     IA  P    D L   +WK ++  AP+N S+   +  +
Sbjct: 140 RARVLVYNP---DIAPNPPDTIDGLLAPEWKGKIGFAPSNASWQSFVTGL 186


>gi|238021789|ref|ZP_04602215.1| hypothetical protein GCWU000324_01692 [Kingella oralis ATCC 51147]
 gi|237866403|gb|EEP67445.1| hypothetical protein GCWU000324_01692 [Kingella oralis ATCC 51147]
          Length = 331

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 74/166 (44%), Gaps = 8/166 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q+      ++ +F + TG+K++       Q       +G  SP DV  T+   +
Sbjct: 24  ITVYNGQHPEATKALVAAFTQDTGIKVTLNSGKGAQLAGQLKEEGAKSPADVFYTEQTAA 83

Query: 85  LA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A      LL ++PA++I + +   V     K  + +S   +V+ Y   ++   D PKSV
Sbjct: 84  FADLSKAGLLAQIPANVIAQTAQKGVPTAAKKDWIALSGRARVVVYDRTKLSEKDFPKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
            D     WK ++   P + +F   +  + +   +    D++K + A
Sbjct: 144 LDFATPAWKDKIGYVPTSGAFLEQVVAIVKMKGQKAALDWLKGLKA 189


>gi|111023981|ref|YP_706953.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110823511|gb|ABG98795.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 78/173 (45%), Gaps = 22/173 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           +T+Y  Q++S+      +F   TG+++     S   +    + +G  SP DV +T++  +
Sbjct: 41  ITVYNAQHESLTQEWADAFTAETGIEVELRNGSDTELGNQLVAEGDQSPADVFLTENSPA 100

Query: 85  LAL----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           + L          N+D+L ++P           +  + K   I+  + V AY+   +   
Sbjct: 101 MTLVENAGLFADVNQDVLDQVPGQY--------RPSSGKWTGIAARSTVFAYNKDTLPQD 152

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            LPKS+ DL +  WK R + +P+   F  +++ + +   +   + ++  +  N
Sbjct: 153 QLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGEDATRQWLAGMKDN 205


>gi|111025325|ref|YP_707745.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110824304|gb|ABG99587.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 79/173 (45%), Gaps = 22/173 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           +T+Y  Q++S+      +F   TG+++     S   +    + +G  SP DV +T++  +
Sbjct: 41  ITVYNAQHESLTQEWADAFTAETGIEVELRNGSDTELGNQLVAEGDQSPADVFLTENSPA 100

Query: 85  LAL----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           + L          N+D+L ++P+          +  + K   I+  + V AY+   +   
Sbjct: 101 MTLVENAGLFADVNQDVLDQVPSQY--------RPSSGKWTGIAARSTVFAYNKDMLPQD 152

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            LPKS+ DL +  WK R + +P+   F  +++ + +   +   + ++  +  N
Sbjct: 153 QLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGEDATRQWLAGMKDN 205


>gi|254427272|ref|ZP_05040979.1| Bacterial extracellular solute-binding protein, putative
           [Alcanivorax sp. DG881]
 gi|196193441|gb|EDX88400.1| Bacterial extracellular solute-binding protein, putative
           [Alcanivorax sp. DG881]
          Length = 338

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 92/185 (49%), Gaps = 17/185 (9%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQRP 66
           L G +E  + E     L +YT +N  ++ P+  ++ E TGV+I      +   T+ +Q  
Sbjct: 19  LWGCSEPTADEE----LVVYTSRNDHLIKPVFDAYTEATGVRIRYITDNASALTARLQAE 74

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQV 123
              + SP D++IT D  +L  A  + LL  + + ++K N    L +  K+   ++   + 
Sbjct: 75  --GERSPADMLITVDAGNLWNAAEKGLLSPVESVVLKNNVPDALTDPKKQWYGLTVRART 132

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIK 182
           L YS  R++ ++L  +  DL + +WK RL +  +   +++ L+ TM +   +   ++ ++
Sbjct: 133 LVYSKDRLQPSEL-STYEDLADPKWKGRLCLRTSKKVYNQSLVATMIERLGEEKAEEIVR 191

Query: 183 NITAN 187
              AN
Sbjct: 192 GWVAN 196


>gi|51892295|ref|YP_074986.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855984|dbj|BAD40142.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 356

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 65/133 (48%), Gaps = 6/133 (4%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSPV-DVIITKDE 82
           K + +YT     +  P+  +FEE TG+K++P+Y ++    QR      +P+ DVI     
Sbjct: 53  KEIVVYTSHQADIHEPLFKAFEEATGIKVTPVYAATGELFQRMRAEANNPLGDVIFGGGA 112

Query: 83  TSLALNEDLLHK-LPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
            +   N+DLL   +P  + K     +  +N      +    V+ Y+T  +   + PKS  
Sbjct: 113 ETHEANKDLLQPYVPKEIDKLAPGTVAKDNSWTGFTALPI-VIMYNTNLLTADEAPKSFA 171

Query: 142 DLTNAQWKKRLSI 154
           DLT+ +W  ++++
Sbjct: 172 DLTDPKWAGKIAM 184


>gi|315635010|ref|ZP_07890291.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
 gi|315476272|gb|EFU67023.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
          Length = 332

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +F + TG+K++     S Q       +G  +P DV  T+   S
Sbjct: 25  ITVYNGQHKEAAKAVTEAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYTEQVAS 84

Query: 85  LAL--NEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
                + DLL  L A +IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FVGLSDADLLEPLSADIIKQTQYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++   P + +F   +  + +   +    D++K +  N
Sbjct: 145 LDYATPKWKDKIGYVPTSGAFLEQVVAITKLKGEKAALDWLKGLKEN 191


>gi|258651887|ref|YP_003201043.1| family 1 extracellular solute-binding protein [Nakamurella
           multipartita DSM 44233]
 gi|258555112|gb|ACV78054.1| extracellular solute-binding protein family 1 [Nakamurella
           multipartita DSM 44233]
          Length = 366

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 73/170 (42%), Gaps = 8/170 (4%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPITQG--SPVDVIITK 80
           T   L +Y+ +N+ ++ P++  F  +TGV +      +  +    +T+G  SP DV  ++
Sbjct: 56  TGGTLVVYSGRNKDLIGPLLDQFSAQTGVAVEFRAGDSGELAAQLLTEGDASPADVFFSQ 115

Query: 81  DETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
           D  +L       L   LPA  ++         +   + +S   +V+ Y+       + P 
Sbjct: 116 DAGALGAVAQAGLFTSLPAATVEAVPAAYAATDGSWVGVSGRARVIVYNPTLAP--NPPD 173

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           ++  L + QWK ++  AP N S+   +  +     +   + ++    A E
Sbjct: 174 TIDGLLDPQWKGQIGFAPTNASWQAFVTGLRVLRGEDGARQWLTAFAAQE 223


>gi|284992052|ref|YP_003410606.1| family 1 extracellular solute-binding protein [Geodermatophilus
           obscurus DSM 43160]
 gi|284065297|gb|ADB76235.1| extracellular solute-binding protein family 1 [Geodermatophilus
           obscurus DSM 43160]
          Length = 343

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 12/150 (8%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKI-------SPIYTSSIQRPPITQGSPVDVI 77
             + LT+Y+ Q++S++  ++  F E TG+ +       + +    +Q     + SP DV 
Sbjct: 34  AAETLTVYSAQHESLVRTMLEGFTEETGIALEFRDANDAELANQIVQE---GEASPADVF 90

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           +T++  S+ +   E LL  L    + +     +  +      +  + VL ++  ++    
Sbjct: 91  LTENSPSIDVLDREGLLAPLDQSTLDQVGAQYRPSSGNWTGFAARSTVLVHNPAQLPQDQ 150

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLL 165
           LP S+ DL N +W+ R+ IA     F  ++
Sbjct: 151 LPASILDLANPEWQGRIGIAAGGADFQAIV 180


>gi|120404072|ref|YP_953901.1| extracellular solute-binding protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956890|gb|ABM13895.1| extracellular solute-binding protein, family 1 [Mycobacterium
           vanbaalenii PYR-1]
          Length = 340

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 78/178 (43%), Gaps = 25/178 (14%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            + T +L L        +E+  K + +Y  ++++++ P+I  F   TG+++   Y  S +
Sbjct: 11  AVITAMLALTACGSGSQSEDADK-IVVYAGRSEALIAPLIEQFTADTGIEVEARYAGSGE 69

Query: 65  RPP--ITQG--SPVDVIITKDETSLA----------LNEDLLHKLPAHLIKKNSFVLKNE 110
                IT+G  SP DV +++D  +L           ++ D L  +PA     +       
Sbjct: 70  LAAQLITEGDKSPADVFLSQDAGALGAVSKAGLFAPISPDTLAAVPAQYSAADG------ 123

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
               + +S   +V+ Y+       + P ++  L   +WK ++  AP+N S+   +  +
Sbjct: 124 --TWVGVSGRARVIVYNPTLAP--NPPDTIDGLLAPEWKGKIGFAPSNASWQAFVTGL 177


>gi|86740297|ref|YP_480697.1| extracellular solute-binding protein [Frankia sp. CcI3]
 gi|86567159|gb|ABD10968.1| extracellular solute-binding protein, family 1 [Frankia sp. CcI3]
          Length = 354

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 86/199 (43%), Gaps = 19/199 (9%)

Query: 2   FKRTIYTYLLLLC-GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI----- 55
             RT+   +   C     A  + +  K +TLY  Q+Q +M  ++ +F ++TG+K+     
Sbjct: 21  LGRTLVVLVTATCLAGLSACGSGDDGKTITLYNAQHQDLMRVMVDAFTKQTGIKVELRRG 80

Query: 56  -SPIYTSSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKK--NSFVLK 108
             P   + I    + +G  SP DV +T++  ++ L        KL    + +  + +V  
Sbjct: 81  GDPELANQI----VQEGDSSPADVFVTENSPAMTLVDRAGRFSKLDRATLGQVPDQYVPS 136

Query: 109 NENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
             N   +  +  + V  Y+  ++   +LP S+ DL    WK ++ +A     F  +++ +
Sbjct: 137 TGN--WVGFAARSTVFIYNRGQVAKNELPTSIMDLAGPAWKGKVGVAAAGADFQAIVSAV 194

Query: 169 EQTPNKTVVQDFIKNITAN 187
                +    +++  +  N
Sbjct: 195 LAVKGEGATAEWLAGLKRN 213


>gi|304312061|ref|YP_003811659.1| ABC-type Fe3+ transport system, periplasmic component [gamma
           proteobacterium HdN1]
 gi|301797794|emb|CBL46016.1| ABC-type Fe3+ transport system, periplasmic component [gamma
           proteobacterium HdN1]
          Length = 354

 Score = 51.6 bits (122), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 9/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKDETS 84
           L +Y+ + + ++ P++  F ++TG+ ++ +       IQR     + +P D++I  D   
Sbjct: 41  LNIYSARKEELIRPLLEKFSKKTGIGVNVVTADDDVLIQRLKAEGRNTPADILIMADAGR 100

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A   DL   + + ++ KN    L+  +     ++   +V+AYS +R+K   L  S  
Sbjct: 101 LVRAAQADLFQPVKSSILNKNIPAQLRQADGLWFGLTIRARVIAYSPERVKPGTL-SSYE 159

Query: 142 DLTNAQWKKRL-SIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +L + QWK R+ S +  N+    L  +M           ++K + AN
Sbjct: 160 NLADPQWKGRICSRSSGNVYNQSLTASMIANDGAEKTDAWLKGMVAN 206


>gi|87122423|ref|ZP_01078303.1| ABC-type Fe3+ transport system, periplasmic component [Marinomonas
           sp. MED121]
 gi|86162216|gb|EAQ63501.1| ABC-type Fe3+ transport system, periplasmic component [Marinomonas
           sp. MED121]
          Length = 357

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 82/167 (49%), Gaps = 9/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--SIQRPPITQG--SPVDVIITKDETS 84
           + +Y+ + ++++ P++  FEE TGV ++ I  S  ++ R    +G  SP D+ IT D   
Sbjct: 42  VNVYSARKEALIKPMLDRFEEETGVAVNLITGSADALLRRLQVEGEYSPADIFITVDAGR 101

Query: 85  LALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L   +      P    K +  V   L++ +     +S  ++ + Y+  R+  ++L  S  
Sbjct: 102 LHRAKQAGVLQPFQTAKIDELVPEHLRDSDDYWYSLSQRSRTIFYAKDRVNKSEL-SSYE 160

Query: 142 DLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            L ++QWK R+ + +  NI    L+ +M +   +   Q ++K + AN
Sbjct: 161 ALADSQWKGRICVRSSGNIYNQSLVASMIEVNGEDATQTWVKGLMAN 207


>gi|158317096|ref|YP_001509604.1| extracellular solute-binding protein [Frankia sp. EAN1pec]
 gi|158112501|gb|ABW14698.1| extracellular solute-binding protein family 1 [Frankia sp. EAN1pec]
          Length = 358

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/190 (18%), Positives = 80/190 (42%), Gaps = 22/190 (11%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSIQRPPIT 69
           +L G   A    +  K LTLY  Q++ +M  ++ +F + TG+K+       + +    + 
Sbjct: 36  ILVGGLSAACGGDDGKTLTLYNAQHRDLMQVLVDAFTKETGIKVEMRNGGDAELANQIVQ 95

Query: 70  QG--SPVDVIITKDETSLA----------LNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +G  SP D+  T++  ++           L++  L ++P   +  +           +  
Sbjct: 96  EGDSSPADLFATENSPAMTLVDRAGGFSPLDQATLDQMPDQYVPSSG--------TWVGF 147

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  ++    LP S+ DL   +W+ R+ +A     F  +++ +     +   
Sbjct: 148 AARSTVFIYNRDQVDKDALPTSIMDLARPEWQGRVGVAAGGADFQAIVSAVLAVEGEDAA 207

Query: 178 QDFIKNITAN 187
            D++  +  N
Sbjct: 208 ADWLAGLKRN 217


>gi|37520583|ref|NP_923960.1| iron(III) ABC transporter iron (III)-binding protein [Gloeobacter
           violaceus PCC 7421]
 gi|35211577|dbj|BAC88955.1| iron(III) ABC transporter iron (III)-binding protein [Gloeobacter
           violaceus PCC 7421]
          Length = 355

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 89/193 (46%), Gaps = 7/193 (3%)

Query: 3   KRTIYTYLLLLCGFTE--AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI---SP 57
           +R +   L +   FT   +      ++ L +Y+ + + ++ P++  F++ TGV++   S 
Sbjct: 23  RRQVLGVLAVGGLFTAVPSVGLAQGSEELVVYSGRKEPLIQPVLERFQKETGVRVVLKSG 82

Query: 58  IYTSSIQRPPITQGSP-VDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
             ++   +    Q +P  DV +  D   L    +L    P           +      + 
Sbjct: 83  DASALANQLLEEQKNPQADVFVANDAGVLGRLGNLGVLQPYQSASIEKIPARYRGAGWVG 142

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKT 175
           ++   +V+ Y+   IK ADLPKS+ DL++ ++K +++ A   N S    L+ M Q     
Sbjct: 143 VTGRARVIMYNKSLIKEADLPKSLLDLSDPKYKGKIAAAGTANESMLGQLSEMRQVLGDE 202

Query: 176 VVQDFIKNITANE 188
             ++F++++ AN+
Sbjct: 203 KTREFVRSLVANQ 215


>gi|302036401|ref|YP_003796723.1| putative Fe3+ ABC transporter periplasmic-binding protein
           [Candidatus Nitrospira defluvii]
 gi|300604465|emb|CBK40797.1| ABC transporter, periplasmic binding component, putative Fe3+
           transport system [Candidatus Nitrospira defluvii]
          Length = 343

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 89/186 (47%), Gaps = 11/186 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPV 74
           A  T    + L +Y+ + + ++ P++  F+ ++G++I  + + + +     Q     +P 
Sbjct: 24  AAGTAEAAEKLVVYSGRAERLIKPVLDEFQAKSGIQIELLSSGTTELVNRLQAEGDHTPA 83

Query: 75  DVIITKDETSLALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTKRI 131
           DV +T D  SL    +L    P ++ +    +    +  +   + +S    ++ Y+T  +
Sbjct: 84  DVFLTNDAGSLEHARELKLLRPMNMREVERAIPSQFRAADNSWIGLSGRFWIVVYNTNLV 143

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNIS--FHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           K  D  KS+FDLT  QWK ++++ PN+ S      ++ ++ T      + F++ + AN  
Sbjct: 144 K-PDQIKSLFDLTQPQWKDKIAV-PNSGSEYLQAGVSVIKATFGDERTKQFLQGLKANAG 201

Query: 190 LTKYKR 195
              Y++
Sbjct: 202 TQVYQK 207


>gi|145223949|ref|YP_001134627.1| extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]
 gi|315444281|ref|YP_004077160.1| ABC-type Fe3+ transporter, periplasmic component [Mycobacterium sp.
           Spyr1]
 gi|145216435|gb|ABP45839.1| extracellular solute-binding protein, family 1 [Mycobacterium
           gilvum PYR-GCK]
 gi|315262584|gb|ADT99325.1| ABC-type Fe3+ transport system, periplasmic component
           [Mycobacterium sp. Spyr1]
          Length = 342

 Score = 50.8 bits (120), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 77/182 (42%), Gaps = 27/182 (14%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F           CG   A   E+  K + +Y+ +++ ++ P+I  F   TG+++   Y 
Sbjct: 11  VFGAVAAVLAFSACGSQPA--GEDADK-IVVYSGRSEELVKPLIEQFTTDTGIQVETRYA 67

Query: 61  SSIQRPP--ITQG--SPVDVIITKDETSLA----------LNEDLLHKLPAHLIKKNSFV 106
            S +     +T+G  SP DV +++D  +L           +N D L  +P      +   
Sbjct: 68  GSGELAAQLLTEGDKSPADVFLSQDAGALGAVSKAGLFAPINADALAAVPKQYSAADG-- 125

Query: 107 LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLN 166
                   + +S   +V+ Y+   +   D P ++  L   +WK ++  AP+N S+   + 
Sbjct: 126 ------TWLGVSGRARVIVYNPTLVP--DPPDTIDGLLAPEWKGKIGFAPSNASWQAFVT 177

Query: 167 TM 168
            +
Sbjct: 178 GL 179


>gi|224826646|ref|ZP_03699747.1| extracellular solute-binding protein family 1 [Lutiella nitroferrum
           2002]
 gi|224601247|gb|EEG07429.1| extracellular solute-binding protein family 1 [Lutiella nitroferrum
           2002]
          Length = 330

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 94/190 (49%), Gaps = 19/190 (10%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ 70
           L+      AF+     + + +Y+ + + ++ P+I ++++ TGV +  +   S +  P+ +
Sbjct: 5   LMFAAVLAAFAGSAMAEEIVVYSARAEQLVKPLIEAYKKETGVDVKLV---SDKEGPLME 61

Query: 71  -------GSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFD 120
                   SP D+++T D  +L  A    LL  + + +++ N    L++   +   +S  
Sbjct: 62  RMRAEGSNSPADILLTVDAGNLWQASKMGLLKPVSSKVLEANIPAHLRDPKNEWFGLSIR 121

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM---EQTPNKT-- 175
            + L Y+T++++ A L  S  DL + +WK +L +  +   +++ L  M   E  P KT  
Sbjct: 122 ARTLFYNTQKVQPAQL-SSYEDLADPKWKGKLCLRTSKKVYNQSLVAMLLSEHGPVKTEK 180

Query: 176 VVQDFIKNIT 185
           +V+ ++ N+ 
Sbjct: 181 IVRGWVDNLA 190


>gi|121634427|ref|YP_974672.1| major ferric iron binding protein [Neisseria meningitidis FAM18]
 gi|120866133|emb|CAM09872.1| major ferric iron binding protein [Neisseria meningitidis FAM18]
 gi|308388821|gb|ADO31141.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis alpha710]
 gi|325203726|gb|ADY99179.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240355]
          Length = 331

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 144 LNYATPKWKNRIGYAPTSGAF 164


>gi|218767768|ref|YP_002342280.1| major ferric iron binding protein [Neisseria meningitidis Z2491]
 gi|60416398|sp|P0A0Y3|FBPA_NEIMA RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Iron(III) periplasmic-binding protein;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|121051776|emb|CAM08082.1| major ferric iron binding protein [Neisseria meningitidis Z2491]
 gi|319410020|emb|CBY90353.1| iron(III)-transport system iron-binding protein FbpB (major ferric
           iron-binding protein; FBP; major iron-regulated protein;
           MIRP; Iron(III) periplasmic binding protein) [Neisseria
           meningitidis WUE 2594]
 gi|325197847|gb|ADY93303.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis G2136]
          Length = 331

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 144 LNYATPKWKNRIGYAPTSGAF 164


>gi|256396524|ref|YP_003118088.1| extracellular solute-binding protein family 1 [Catenulispora
           acidiphila DSM 44928]
 gi|256362750|gb|ACU76247.1| extracellular solute-binding protein family 1 [Catenulispora
           acidiphila DSM 44928]
          Length = 348

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 77/186 (41%), Gaps = 15/186 (8%)

Query: 14  CGFTEAFSTENTT---KYLTLYTDQNQSVMLPIIHSFEERTGVKI-------SPIYTSSI 63
           CG + + ++   T   + +T+Y+ Q++  +  ++  FE+RTGVK+       + +    +
Sbjct: 24  CGSSASKASAGGTSSGQSITVYSGQHEQTVKALVADFEKRTGVKVELRSGDEAELANQLL 83

Query: 64  QRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
           Q       SP DV   ++  +L +   + LL  +    +K       +     + +S   
Sbjct: 84  QE---GSASPADVFYAENPPALTMLDEKGLLAPVAPDALKAVPAADSSPKGDWLGVSARA 140

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
                +T        P S+ DL   +WK RL IAP+   F  ++  M         + ++
Sbjct: 141 AAFIAATGSAADTAPPTSLRDLAKPEWKGRLGIAPSETDFAPVITRMIAADGVEATKAWL 200

Query: 182 KNITAN 187
             + AN
Sbjct: 201 VGLKAN 206


>gi|15676534|ref|NP_273677.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis MC58]
 gi|161869567|ref|YP_001598734.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis 053442]
 gi|254804517|ref|YP_003082738.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|261401098|ref|ZP_05987223.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria lactamica ATCC 23970]
 gi|304388120|ref|ZP_07370246.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Neisseria meningitidis ATCC 13091]
 gi|60392270|sp|P0A0Y4|FBPA_NEIMB RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Iron(III) periplasmic-binding protein;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|7225862|gb|AAF41057.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis MC58]
 gi|161595120|gb|ABX72780.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis 053442]
 gi|254668059|emb|CBA04515.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|261392998|emb|CAX50584.1| iron(III)-transport system iron-binding protein FbpB (major ferric
           iron-binding protein; FBP; major iron-regulated protein;
           MIRP; Iron(III) periplasmic binding protein) [Neisseria
           meningitidis 8013]
 gi|269208994|gb|EEZ75449.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria lactamica ATCC 23970]
 gi|304337890|gb|EFM04033.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Neisseria meningitidis ATCC 13091]
 gi|325127753|gb|EGC50662.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis N1568]
 gi|325131915|gb|EGC54615.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M6190]
 gi|325133851|gb|EGC56507.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M13399]
 gi|325135772|gb|EGC58384.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M0579]
 gi|325137966|gb|EGC60541.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis ES14902]
 gi|325139815|gb|EGC62347.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis CU385]
 gi|325143980|gb|EGC66290.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240013]
 gi|325200680|gb|ADY96135.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis H44/76]
 gi|325202572|gb|ADY98026.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240149]
 gi|325206519|gb|ADZ01972.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M04-240196]
 gi|325207678|gb|ADZ03130.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis NZ-05/33]
          Length = 331

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 144 LNYATPKWKNRIGYAPTSGAF 164


>gi|225075818|ref|ZP_03719017.1| hypothetical protein NEIFLAOT_00834 [Neisseria flavescens
           NRL30031/H210]
 gi|224952851|gb|EEG34060.1| hypothetical protein NEIFLAOT_00834 [Neisseria flavescens
           NRL30031/H210]
          Length = 331

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 144 LNYATPKWKNRIGYAPTSGAF 164


>gi|45038|emb|CAA37561.1| unnamed protein product [Neisseria meningitidis]
          Length = 330

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 144 LNYATPKWKNRIGYAPTSGAF 164


>gi|325129733|gb|EGC52542.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis OX99.30304]
          Length = 318

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 11  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 70

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 71  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 130

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 131 LNYATPKWKNRIGYAPTSGAF 151


>gi|45014|emb|CAA46070.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45046|emb|CAA46069.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45052|emb|CAA46065.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45058|emb|CAA46068.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45102|emb|CAA46071.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45158|emb|CAA46067.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45174|emb|CAA46066.1| periplasmic iron-binding protein [Neisseria meningitidis]
          Length = 317

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 16  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 75

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 76  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 135

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 136 LNYATPKWKNRIGYAPTSGAF 156


>gi|45245|emb|CAA46064.1| periplasmic iron-binding protein [Neisseria meningitidis]
          Length = 317

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 16  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 75

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 76  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 135

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+  AP + +F
Sbjct: 136 LNYATPKWKNRIGYAPTSGAF 156


>gi|226349510|ref|YP_002776624.1| putative iron(III) ABC transporter iron(III)-binding protein
           [Rhodococcus opacus B4]
 gi|226245425|dbj|BAH55772.1| putative iron(III) ABC transporter iron(III)-binding protein
           [Rhodococcus opacus B4]
          Length = 345

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 87/196 (44%), Gaps = 27/196 (13%)

Query: 10  LLLLCGFTEAFSTENT----TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--I 63
           +L + G +++ S   T       +T+Y  Q++S+      +F   TG+++     S   +
Sbjct: 18  VLTVAGCSDSGSDNGTDSGAANQITVYNAQHESLTQEWADAFTAETGIEVELRNGSDTEL 77

Query: 64  QRPPITQG--SPVDVIITKDETSLALNE----------DLLHKLPAHLIKKNSFVLKNEN 111
               + +G  SP DV +T++  ++ L E          D+L ++P           +  +
Sbjct: 78  GNQLVAEGDQSPADVFLTENSPAMTLVENAGLFADVHRDVLDQVPGQY--------RPSS 129

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQT 171
            K   I+  + V AY+ K +    LPKS+ DL +  WK R + +P+   F  +++ + + 
Sbjct: 130 GKWTGIAARSTVFAYN-KDMLPDQLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLEL 188

Query: 172 PNKTVVQDFIKNITAN 187
             +   + ++  +  N
Sbjct: 189 KGEDATRQWLAGMKEN 204


>gi|91217373|ref|ZP_01254333.1| ferric iron uptake ABC transporter (FeT) family, substrate binding
           protein [Psychroflexus torquis ATCC 700755]
 gi|91184481|gb|EAS70864.1| ferric iron uptake ABC transporter (FeT) family, substrate binding
           protein [Psychroflexus torquis ATCC 700755]
          Length = 342

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 97/194 (50%), Gaps = 16/194 (8%)

Query: 7   YTYLLLLCGFTEAFSTE---NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           Y Y +++  F     +E      + LT+YT ++      +   FE++  +K++ +  S+ 
Sbjct: 4   YFYAIIMVAFVLGCKSEPKEEKVEELTVYTHRHYESDQALFKLFEKQNDIKLNVVNASAD 63

Query: 63  --IQRPPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKL 114
             IQ+  +  + SP DV+IT D   L  A +E LL  +   LI  +S V   L++ +K+ 
Sbjct: 64  ELIQKMKLEGKQSPADVLITVDAGRLYRAKSEGLLQPISNSLI--DSIVPANLRDTDKQW 121

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
           + ++   +V+ YS  R+   DL  +  DLT+ +WK ++ + + +NI    LL ++    +
Sbjct: 122 VGLTKRARVIVYSKDRVDPNDLS-TYEDLTSEKWKNKILVRSSSNIYNQSLLASLISNQS 180

Query: 174 KTVVQDFIKNITAN 187
           K   +++   +  N
Sbjct: 181 KDFAEEWANGLVEN 194


>gi|317125279|ref|YP_004099391.1| extracellular solute-binding protein family 1 [Intrasporangium
           calvum DSM 43043]
 gi|315589367|gb|ADU48664.1| extracellular solute-binding protein family 1 [Intrasporangium
           calvum DSM 43043]
          Length = 342

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 80/182 (43%), Gaps = 9/182 (4%)

Query: 14  CGFTE-AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQ 70
           CG    A +TE     L +Y+ +++S++  I+      TGVK+   Y  S +     + +
Sbjct: 22  CGSDGPADTTEGAD--LVIYSGRSESLVKGILDDLAAETGVKVGVRYAGSSELAAQLLEE 79

Query: 71  GSP--VDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAY 126
           G     DV  ++D  +L     E  L  L A +  +      + +   +  S   +V+AY
Sbjct: 80  GDATKADVFFSQDAGALGALAKEGRLEPLDAAVTDRVIAGFADPDGHWVGTSARARVIAY 139

Query: 127 STKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           + ++    +   SV  + + ++K ++  AP N SFH  +  +     +   ++++    A
Sbjct: 140 NPQQAPEVEQMTSVDAVLDPKYKGKIGYAPANASFHAFVTALRVAKGEDGAREWLTKFKA 199

Query: 187 NE 188
           NE
Sbjct: 200 NE 201


>gi|317130158|ref|YP_004096440.1| extracellular solute-binding protein family 1 [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475106|gb|ADU31709.1| extracellular solute-binding protein family 1 [Bacillus
           cellulosilyticus DSM 2522]
          Length = 354

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 3/146 (2%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQ 64
           + T LL   G     S  +    L +Y+ +N++ + P++  F E TG+++S ++ +  +Q
Sbjct: 13  VSTGLLATTGCGNDGSAVDGEGELVVYSSRNENFVQPLLDKFTEETGIEVSALHGADPLQ 72

Query: 65  RPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
                     D+ I+ D  +L    NE LL       I       K ++     IS  ++
Sbjct: 73  LQEEAGNVQADIFISNDLGALGYLHNEGLLEGSNPEGIDTIPADFKADDNAYFAISARSR 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQW 148
              Y+   I   ++P S+ DL +A+W
Sbjct: 133 GFIYNKDLITEEEMPTSIEDLFDAEW 158


>gi|240127606|ref|ZP_04740267.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268685986|ref|ZP_06152848.1| major ferric iron binding protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626270|gb|EEZ58670.1| major ferric iron binding protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 331

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 74/164 (45%), Gaps = 8/164 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            +    +WK R+   P + +F   +  + +   + V   ++K +
Sbjct: 144 LNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAVALKWLKGL 187


>gi|34497363|ref|NP_901578.1| ABC transporter, iron binding protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34103219|gb|AAQ59582.1| ABC transporter, iron binding protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 330

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 89/173 (51%), Gaps = 19/173 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSPVDVIITKD 81
           + +Y+ + + ++ PI+ ++++ TGV +  +   S +  P+ +        SP D+++T D
Sbjct: 23  VVVYSARGEQLLKPIVEAYKKETGVSVKLV---SDKEGPLMERLRAEGRNSPADLLLTVD 79

Query: 82  ETSLALNE--DLLHKLPAHLIKKNSFV-LKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
             +L   E   LL  + + ++  N    L++  ++   +S   + + Y+T+++K + L  
Sbjct: 80  AGNLWQAERMGLLKAVQSPVLDANVPAHLRDPARQWYGLSIRARTIFYNTQKVKPSQL-S 138

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHRLLNTM---EQTPNKT--VVQDFIKNITA 186
           S  DL + +WK +L +  +   +++ L  M   E  P KT  V++ ++ N+ A
Sbjct: 139 SYADLADPKWKGKLCLRTSKKVYNQSLVGMMLAETGPAKTEQVIKGWVGNLAA 191


>gi|254670777|emb|CBA07081.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha153]
          Length = 306

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 8/139 (5%)

Query: 31  LYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETSLA 86
           +Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +LA
Sbjct: 1   MYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALA 60

Query: 87  L--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
                +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV +
Sbjct: 61  TLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLN 120

Query: 143 LTNAQWKKRLSIAPNNISF 161
               +WK R+  AP + +F
Sbjct: 121 YATPKWKNRIGYAPTSGAF 139


>gi|288554838|ref|YP_003426773.1| iron (III) ABC transporter iron (III)-binding protein [Bacillus
           pseudofirmus OF4]
 gi|288545998|gb|ADC49881.1| ABC iron (III) transport system (iron (III)-binding protein)
           [Bacillus pseudofirmus OF4]
          Length = 365

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 65/134 (48%), Gaps = 5/134 (3%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--SIQRPPITQG-SPVDVIITKDE 82
           T  L +Y+ +N++ +  ++  F   TG+++ P++    ++ R     G +  D+ I+ D 
Sbjct: 52  TGELVVYSSRNENFVNALLEKFTADTGIEVKPLHAGDNAVSRIKGEAGNAQADIFISNDV 111

Query: 83  TSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L     E LL       I+      + E+     +S  T+VL Y+   I   ++PKS+
Sbjct: 112 GALENLRLEGLLEGSDPEGIESIDEKYRAEDNSWFALSARTRVLMYNKDLITEEEMPKSI 171

Query: 141 FDLTNAQWKKRLSI 154
            DLT+ +W+   +I
Sbjct: 172 EDLTDPKWQGEFAI 185


>gi|293390932|ref|ZP_06635266.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951466|gb|EFE01585.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 332

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV  ++    
Sbjct: 25  ITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYSEQTAP 84

Query: 85  LA-LNE-DLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++   P + +F   +  + +   +    D++K +  N  L
Sbjct: 145 LDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKL 194


>gi|2340838|dbj|BAA21842.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans]
          Length = 332

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV  ++    
Sbjct: 25  ITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYSEQTAP 84

Query: 85  LA-LNE-DLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++   P + +F   +  + +   +    D++K +  N  L
Sbjct: 145 LDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKL 194


>gi|261867323|ref|YP_003255245.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412655|gb|ACX82026.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 332

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV  ++    
Sbjct: 25  ITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYSEQTAP 84

Query: 85  LA-LNE-DLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++   P + +F   +  + +   +    D++K +  N  L
Sbjct: 145 LDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKL 194


>gi|119851|sp|P17259|FBP_NEIGO RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|44858|emb|CAA36182.1| unnamed protein product [Neisseria gonorrhoeae]
          Length = 330

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 144 LNYATPKWKNRIGYVPTSGAF 164


>gi|47168691|pdb|1R1N|A Chain A, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168692|pdb|1R1N|B Chain B, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168693|pdb|1R1N|C Chain C, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168694|pdb|1R1N|D Chain D, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168695|pdb|1R1N|E Chain E, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168696|pdb|1R1N|F Chain F, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168697|pdb|1R1N|G Chain G, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168698|pdb|1R1N|H Chain H, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168699|pdb|1R1N|I Chain I, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|55670810|pdb|1XC1|A Chain A, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670811|pdb|1XC1|B Chain B, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670812|pdb|1XC1|C Chain C, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670813|pdb|1XC1|D Chain D, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670814|pdb|1XC1|E Chain E, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670815|pdb|1XC1|F Chain F, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670816|pdb|1XC1|G Chain G, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670817|pdb|1XC1|H Chain H, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670818|pdb|1XC1|I Chain I, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
          Length = 309

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 2   ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 61

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 62  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 122 LNYATPKWKNRIGYVPTSGAF 142


>gi|59800670|ref|YP_207382.1| ABC transporter, periplasmic binding protein, iron related
           [Neisseria gonorrhoeae FA 1090]
 gi|194097929|ref|YP_002000975.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998402|ref|ZP_04718326.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           35/02]
 gi|240013527|ref|ZP_04720440.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           DGI18]
 gi|240015965|ref|ZP_04722505.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           FA6140]
 gi|240080106|ref|ZP_04724649.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           FA19]
 gi|240112318|ref|ZP_04726808.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           MS11]
 gi|240115059|ref|ZP_04729121.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID18]
 gi|240117344|ref|ZP_04731406.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID1]
 gi|240120599|ref|ZP_04733561.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID24-1]
 gi|240122895|ref|ZP_04735851.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID332]
 gi|240125151|ref|ZP_04738037.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493121|ref|ZP_05106292.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae 1291]
 gi|260441125|ref|ZP_05794941.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           DGI2]
 gi|268594261|ref|ZP_06128428.1| major ferric iron-binding protein [Neisseria gonorrhoeae 35/02]
 gi|268596258|ref|ZP_06130425.1| major ferric iron-binding protein [Neisseria gonorrhoeae FA19]
 gi|268598379|ref|ZP_06132546.1| major ferric iron binding protein [Neisseria gonorrhoeae MS11]
 gi|268600734|ref|ZP_06134901.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID18]
 gi|268603040|ref|ZP_06137207.1| major ferric iron binding protein [Neisseria gonorrhoeae PID1]
 gi|268681515|ref|ZP_06148377.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID332]
 gi|268683745|ref|ZP_06150607.1| major ferric iron binding protein [Neisseria gonorrhoeae SK-92-679]
 gi|291044456|ref|ZP_06570165.1| major ferric iron-binding protein [Neisseria gonorrhoeae DGI2]
 gi|293397590|ref|ZP_06641796.1| iron(III) transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|1098687|gb|AAB63559.1| binds iron in a manner similar to transferrin; periplasmic
           iron-binding protein; Method: conceptual translation
           supplied by author [Neisseria gonorrhoeae]
 gi|59717565|gb|AAW88970.1| ABC transporter, periplasmic binding protein, iron related
           [Neisseria gonorrhoeae FA 1090]
 gi|193933219|gb|ACF29043.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512161|gb|EEH61506.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae 1291]
 gi|268547650|gb|EEZ43068.1| major ferric iron-binding protein [Neisseria gonorrhoeae 35/02]
 gi|268550046|gb|EEZ45065.1| major ferric iron-binding protein [Neisseria gonorrhoeae FA19]
 gi|268582510|gb|EEZ47186.1| major ferric iron binding protein [Neisseria gonorrhoeae MS11]
 gi|268584865|gb|EEZ49541.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID18]
 gi|268587171|gb|EEZ51847.1| major ferric iron binding protein [Neisseria gonorrhoeae PID1]
 gi|268621799|gb|EEZ54199.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID332]
 gi|268624029|gb|EEZ56429.1| major ferric iron binding protein [Neisseria gonorrhoeae SK-92-679]
 gi|291011350|gb|EFE03346.1| major ferric iron-binding protein [Neisseria gonorrhoeae DGI2]
 gi|291611536|gb|EFF40605.1| iron(III) transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|317163688|gb|ADV07229.1| ABC transporter, periplasmic binding protein, iron related protein
           [Neisseria gonorrhoeae TCDC-NG08107]
 gi|1588872|prf||2209379A fbpA gene
          Length = 331

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 24  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 144 LNYATPKWKNRIGYVPTSGAF 164


>gi|251793332|ref|YP_003008060.1| ferric iron binding protein [Aggregatibacter aphrophilus NJ8700]
 gi|247534727|gb|ACS97973.1| ferric iron binding protein [Aggregatibacter aphrophilus NJ8700]
          Length = 332

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 78/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +F + TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 25  ITVYNGQHKEAAKAVTEAFMKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYTEQIGT 84

Query: 85  LA--LNEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A   ++ LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FAELSDKGLLEPLSAETIKQTEYKGVPVAPKKDWVALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++   P + +F   +  + +  ++    D++K +  N  L
Sbjct: 145 LDYATPKWKDKIGYVPTSGAFLSQVIAITKLKSEQAALDWLKGLKENGKL 194


>gi|44849|emb|CAA46063.1| periplasmic iron-binding protein [Neisseria gonorrhoeae]
          Length = 317

 Score = 48.1 bits (113), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 16  ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 75

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 76  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 135

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 136 LNYATPKWKNRIGYVPTSGAF 156


>gi|28948312|pdb|1O7T|A Chain A, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948313|pdb|1O7T|B Chain B, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948314|pdb|1O7T|C Chain C, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948315|pdb|1O7T|D Chain D, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948316|pdb|1O7T|E Chain E, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948317|pdb|1O7T|F Chain F, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948318|pdb|1O7T|G Chain G, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948319|pdb|1O7T|H Chain H, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948320|pdb|1O7T|I Chain I, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae
          Length = 309

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 2   ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 61

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 62  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 122 LNYATPKWKNRIGYVPTSGAF 142


>gi|383959|prf||1904330A ferric iron-binding protein
          Length = 308

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG  VK++      +      +GS  P DV  ++   +
Sbjct: 2   ITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPA 61

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 62  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 122 LNYATPKWKNRIGYVPTSGAF 142


>gi|6573535|pdb|1D9Y|A Chain A, Neisseria Gonorrhoeae Ferric Binding Protein
          Length = 309

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 8/141 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG+K+        Q       +GS  P DV  ++   +
Sbjct: 2   ITVYNGQHKEAAQAVADAFTRATGIKVKLNCAKGDQLAGQIKEEGSRSPADVFYSEQIPA 61

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 62  LATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISF 161
            +    +WK R+   P + +F
Sbjct: 122 LNYATPKWKNRIGYVPTSGAF 142


>gi|325578694|ref|ZP_08148770.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325159733|gb|EGC71864.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 332

 Score = 47.8 bits (112), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 16/197 (8%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F+    T L+   GF  A         +T+Y  Q++     +  +F + TG+K++     
Sbjct: 6   FQIAALTGLMAFAGFASA--------DITVYNGQHKEGAKAVADAFTKATGIKVTLNSAK 57

Query: 62  SIQRPPI--TQG--SPVDVIITKDETSLALNED--LLHKLPAHLIKKNSF--VLKNENKK 113
           S Q       +G  +P DV  ++     A   D  LL  L A  IK+ +   V     K 
Sbjct: 58  SDQLAGQLKEEGDKTPADVFFSEQTAPFAALSDAGLLEPLSADTIKQTAHKGVPVAPKKD 117

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
            + +S  ++V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +   
Sbjct: 118 WVALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVVAITKLKG 177

Query: 174 KTVVQDFIKNITANEIL 190
           K     ++K +  N  L
Sbjct: 178 KDAALKWLKGLKENGKL 194


>gi|301155985|emb|CBW15455.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 332

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 16/197 (8%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F+    T L+   GF  A         +T+Y  Q++     +  +F + TG+K++     
Sbjct: 6   FQIAALTGLMAFAGFASA--------DITVYNGQHKEGSQAVADAFTKATGIKVTLNSAK 57

Query: 62  SIQRPPI--TQG--SPVDVIITKDETSLALNED--LLHKLPAHLIKKNSF--VLKNENKK 113
           S Q       +G  +P DV  ++     A   D  LL  L A  IK+ +   V     K 
Sbjct: 58  SDQLAGQLKEEGDKTPADVFFSEQTAPFAALSDAGLLEPLSADTIKQTAHKGVPVAPKKD 117

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
            + +S  ++V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +   
Sbjct: 118 WVALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVVAITKLKG 177

Query: 174 KTVVQDFIKNITANEIL 190
           K     ++K +  N  L
Sbjct: 178 KDAALKWLKGLKENGKL 194


>gi|331005996|ref|ZP_08329339.1| Ferric iron ABC transporter, iron-binding protein [gamma
           proteobacterium IMCC1989]
 gi|330420172|gb|EGG94495.1| Ferric iron ABC transporter, iron-binding protein [gamma
           proteobacterium IMCC1989]
          Length = 342

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 95/197 (48%), Gaps = 23/197 (11%)

Query: 8   TYLLLLCGFTEAFSTENTTK--YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           T L+ +  F+   +     K   +T+Y+ + + ++ P+   +  +TG ++  I   + + 
Sbjct: 12  TALVSVLSFSPVVAATEAAKDNVITVYSSRKEHLIKPLFDRYTAKTGTQVRFI---TDKA 68

Query: 66  PPI-----TQGS--PVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLM 115
            P+      +G+  P D+ +T D   L  A  EDL  K+ + +++      L++      
Sbjct: 69  GPLMARLKAEGASTPADIFMTVDAGVLWQASEEDLFRKVDSPVLEAAVPANLQSAKDDWY 128

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTME 169
            +S   + L YST R+K +DL  S ++ L N  WK R+ +  +   +++     ++NT+ 
Sbjct: 129 GLSIRARTLVYSTDRVKPSDL--STYEALANDDWKGRVCLRTSKKIYNKSLVATMINTLG 186

Query: 170 QTPNKTVVQDFIKNITA 186
           +   + +V+ ++ N+ A
Sbjct: 187 EEKTEAIVKGWVANLAA 203


>gi|4514347|dbj|BAA75385.1| Yvfk [Bacillus halodurans]
          Length = 303

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--SIQRPPITQGS-PVDVIITKD 81
            T  L +Y+ +N+  +  ++  FE+ TG+ + P++    ++ R     G+   D+ I+ D
Sbjct: 58  GTGELVVYSSRNEDFVNALLEKFEQDTGITVQPLHAGDNAVNRIKGEAGNVQADIFISND 117

Query: 82  ETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             +L     E LL       ++      + E+   + +S  T+VL Y+   I   ++PK+
Sbjct: 118 IGALEHLRLEGLLEGSDPEGVESIDEKYRAEDNSWIALSARTRVLMYNKDLISEEEMPKT 177

Query: 140 VFDLTNAQWKKRLSI 154
           + +LT+ +W+   +I
Sbjct: 178 IEELTDPKWEGDFAI 192


>gi|323488303|ref|ZP_08093552.1| iron ABC transporter substrate-binding protein [Planococcus
           donghaensis MPA1U2]
 gi|323398055|gb|EGA90852.1| iron ABC transporter substrate-binding protein [Planococcus
           donghaensis MPA1U2]
          Length = 339

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 82/193 (42%), Gaps = 18/193 (9%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           + +  CG  E  S    +K L++Y+     ++ PI+  F++RTG+K+  +   +   + R
Sbjct: 15  FTIAACGSDENESEATDSKTLSVYSPHQSEIINPIVKEFQDRTGIKVELVQGGTGELLSR 74

Query: 66  PPITQGSP-VDVIITKDETSLALNEDLLHKLPAHLIKKNSF---VLKNENKKLMRISFDT 121
                 +P  D+       SL   E        ++ K++     V K+E       S   
Sbjct: 75  VSAEAKNPGADIFWGGGAESL---EAFGENFEPYITKEDEMIPDVFKSETGVWTGFSALP 131

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA-PN--NISFHRLLNTM-----EQTPN 173
            V+ Y+   ++ +D+P S   L + +WK +++   PN    S+ +L+  +     +    
Sbjct: 132 MVIMYNEDMVEESDVPASWEALIDEKWKGKIAFTDPNKSGSSYTQLVTMLTAYEDDGDNG 191

Query: 174 KTVVQDFIKNITA 186
              V DF+ N+  
Sbjct: 192 WNFVNDFVANLDG 204


>gi|15613076|ref|NP_241379.1| iron (III) transport system (iron (III)-binding protein) [Bacillus
           halodurans C-125]
 gi|10173126|dbj|BAB04232.1| iron (III) transport system (iron (III)-binding protein) [Bacillus
           halodurans C-125]
          Length = 372

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--SIQRPPITQGS-PVDVIITKD 81
            T  L +Y+ +N+  +  ++  FE+ TG+ + P++    ++ R     G+   D+ I+ D
Sbjct: 58  GTGELVVYSSRNEDFVNALLEKFEQDTGITVQPLHAGDNAVNRIKGEAGNVQADIFISND 117

Query: 82  ETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             +L     E LL       ++      + E+   + +S  T+VL Y+   I   ++PK+
Sbjct: 118 IGALEHLRLEGLLEGSDPEGVESIDEKYRAEDNSWIALSARTRVLMYNKDLISEEEMPKT 177

Query: 140 VFDLTNAQWKKRLSI 154
           + +LT+ +W+   +I
Sbjct: 178 IEELTDPKWEGDFAI 192


>gi|226941550|ref|YP_002796624.1| FbpA [Laribacter hongkongensis HLHK9]
 gi|226716477|gb|ACO75615.1| FbpA [Laribacter hongkongensis HLHK9]
          Length = 332

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 91/175 (52%), Gaps = 17/175 (9%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVII 78
           T + +T+Y+ +N+ ++ P+  ++ + TGV++   + +  + P + +       +P D+++
Sbjct: 21  TAEEITVYSARNEQLIKPLFDAYSKETGVQVR--FITDKEGPLMARLAAEGKNTPADILM 78

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L  A N  LL  + +  +++N    L++   +   ++   + + ++T+ +K AD
Sbjct: 79  TVDAGNLWQAANAGLLKPVHSRTLEQNVPAHLRDPKGQWFGLAVRARTIFFNTRTVKPAD 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM---EQTPNKT--VVQDFIKNIT 185
           L  S   L + +W+ RL +  +   +++ L  M   E    KT  +V+ +++N+ 
Sbjct: 139 L-SSYEALADPKWRGRLCLRTSKKVYNQSLVGMMMAEHGAAKTEQIVKGWVRNLA 192


>gi|292669460|ref|ZP_06602886.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas noxia ATCC 43541]
 gi|292648913|gb|EFF66885.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas noxia ATCC 43541]
          Length = 189

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRP 66
           +L+ CG +E  S++     L +Y         PI+  F+E+TG+++  +   S   + R 
Sbjct: 27  VLVGCGGSEQ-SSKAEDNILVVYNCNTDDWTAPIVKEFQEQTGIQVQLVAGGSGELMARV 85

Query: 67  PITQGSPV-DVIITKDETSLALNEDLLHKLPAHLIKKNS----FVLKNENKKLMRISFDT 121
              + +P+ D++      +    E  L   P    +K +    FV   EN     ++ D 
Sbjct: 86  RAEKENPLGDIMWGGSADAYVALEPFLQ--PYESTEKAAIDPNFV--RENNAFYNVTMDP 141

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA 155
            V+AY+T  +  AD PK   DL + +++ R+S+A
Sbjct: 142 YVIAYNTDLVSEADAPKGWKDLLDPKFRGRISLA 175


>gi|82701865|ref|YP_411431.1| extracellular solute-binding protein [Nitrosospira multiformis ATCC
           25196]
 gi|82409930|gb|ABB74039.1| extracellular solute-binding protein, family 1 [Nitrosospira
           multiformis ATCC 25196]
          Length = 337

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 97/193 (50%), Gaps = 19/193 (9%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ- 70
           ++C  T   +  +  + + +Y+ + + ++ P+  +F + +GV +   + +  + P + + 
Sbjct: 13  MICCVTLFTADASGAEDVVVYSARIEQLIKPMFDAFTKDSGVAVK--FVTDKEGPLLARL 70

Query: 71  -----GSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLMRISFDTQ 122
                 +P DV++T D  +L  A  E LL  + + +++ N    L++  K+   +S   +
Sbjct: 71  KAEGKNTPADVLLTTDAGNLWEAAREGLLRPVESEILETNVPAHLRDPLKRWFGLSIRAR 130

Query: 123 VLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHRLLNTM---EQTPNKT--V 176
            + Y+T ++K +DL  S ++ L + +WK RL I  +   +++ L  M   E    KT  +
Sbjct: 131 TIVYNTNKVKPSDL--STYEALADPKWKNRLCIRTSKKVYNQSLVAMMIAEHGEPKTEQI 188

Query: 177 VQDFIKNITANEI 189
           V+ +I N+  + +
Sbjct: 189 VKGWITNLATDPL 201


>gi|319775037|ref|YP_004137525.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3047]
 gi|329123055|ref|ZP_08251626.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus aegyptius ATCC 11116]
 gi|317449628|emb|CBY85834.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3047]
 gi|327471986|gb|EGF17426.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus aegyptius ATCC 11116]
          Length = 332

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 9/180 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPV 74
           AFS  N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P 
Sbjct: 16  AFSA-NSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPA 74

Query: 75  DVIITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKR 130
           DV  T+   + A L+E  LL  +    IK+ +   V     K  + +S  ++V+ Y   +
Sbjct: 75  DVFYTEQTATFAALSEAGLLAPISEQTIKQTAQKGVPLAPKKDWVALSGRSRVVVYDHTK 134

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           +   D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 135 LSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|256828551|ref|YP_003157279.1| family 1 extracellular solute-binding protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577727|gb|ACU88863.1| extracellular solute-binding protein family 1 [Desulfomicrobium
           baculatum DSM 4028]
          Length = 333

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 39/177 (22%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKI------SPIYTSSIQRPPITQGSPVDVIITKDE 82
           L +Y+ + + ++ P+  ++  +TGVKI       P+    ++     + +P D++IT D 
Sbjct: 26  LVVYSARAEQLIKPLFDAYTAKTGVKIQYVTDKEPVLLERLKAE--GERTPADMLITVDA 83

Query: 83  TSLAL-----------NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
            +L L           +E L   +P H        L++   K   +S   + + Y+T ++
Sbjct: 84  GNLWLAGEAGVISPVQSETLAANIPDH--------LRDPGNKWFGLSLRARTIVYNTGKV 135

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           K ADL  +   L   +WK RL           LL T ++  N+++V   I  +   E
Sbjct: 136 KPADL-STYAALAGPEWKGRL-----------LLRTSKKVYNQSLVAALIAELGEAE 180


>gi|325972472|ref|YP_004248663.1| extracellular solute-binding protein family 1 [Spirochaeta sp.
           Buddy]
 gi|324027710|gb|ADY14469.1| extracellular solute-binding protein family 1 [Spirochaeta sp.
           Buddy]
          Length = 337

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 74/167 (44%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSPV-DVIITKDETS 84
           LTLY         PII  F++RTG+K++ +   +   + R    + +P+ DV+      S
Sbjct: 34  LTLYYSHAADWTDPIIKEFQDRTGIKVNLVGAGTGELVSRIRAEKDNPLSDVLWGGGSDS 93

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
             +  +LL       + K   V ++   +    + D  V+ Y+ K +  AD PK   DL 
Sbjct: 94  YQVIVELLEPYSHAHMDKVLPVTRDPGNRWHGTTIDPMVIIYNPKLVAEADAPKGWADLL 153

Query: 145 NAQWKKRLSIAP---NNISFHRL-LNTMEQTPNKTVVQDFIKNITAN 187
           N ++K R++ A    +  SF  L +  +    +  V   ++KN   N
Sbjct: 154 NPKFKGRIAHADPARSGSSFMALIIQLLSMGGDNEVGWTYMKNFVTN 200


>gi|40062841|gb|AAR37718.1| iron ABC transporter, iron-binding protein, putative [uncultured
           marine bacterium 441]
          Length = 338

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 74/140 (52%), Gaps = 10/140 (7%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVII 78
           +  T  +T+Y+ + + ++ P+   F ++TG++++ +  S    I+R  +    +P D+ +
Sbjct: 25  QAATDDVTVYSSRKEHLIQPLFEQFTKQTGIEVNYLTGSGGDLIERLKLEGANTPADMFM 84

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKKN--SFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           T D   L  A  +D+   +   +++ N  S+ L++ N     +S   + + YST R+  +
Sbjct: 85  TVDAGDLWYAGTQDIFQPIVTDVLESNIPSY-LRDPNGLWTGLSVRARTIVYSTDRVSES 143

Query: 135 DLPKSVFDLTNAQWKKRLSI 154
           DL  +  DL +++W K+L +
Sbjct: 144 DL-STYGDLASSKWNKKLCL 162


>gi|296315008|ref|ZP_06864949.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria polysaccharea ATCC 43768]
 gi|296838209|gb|EFH22147.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria polysaccharea ATCC 43768]
          Length = 331

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 75/170 (44%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F + TG  VKI+   +  +      +GS  P DV  ++    
Sbjct: 24  ITVYNGQHKEATQALADAFTQATGIKVKINSGKSDQLAGQIKEEGSRSPADVFYSEQIPP 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            +    +WK R+   P + +F   +  + +   +     ++K +  N  L
Sbjct: 144 LNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKL 193


>gi|159184297|ref|NP_353437.2| ABC transporter, substrate binding protein (iron) [Agrobacterium
           tumefaciens str. C58]
 gi|159139622|gb|AAK86222.2| ABC transporter, substrate binding protein (iron) [Agrobacterium
           tumefaciens str. C58]
          Length = 338

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (47%), Gaps = 17/160 (10%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKY-LTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSS 62
           T +T   LL   T AF+    +   L +YT +   ++ P++ SF   +GVK++ ++    
Sbjct: 2   TKFTRFALLAS-TVAFAAGTVSAAELNIYTTREPGLIQPLLESFTASSGVKVNTVFLKDG 60

Query: 63  IQRPPITQG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFV------LKNENKKL 114
           +    +++G  SP DV++T D  +L    DL  K     ++  +        L++     
Sbjct: 61  LAERVLSEGASSPADVLMTVDAGNLV---DLAEKGVTQAVESETLTKAVPAELRDAKGHW 117

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
             +S   +VL Y+ K + +A    +  DL +A+WK ++ I
Sbjct: 118 FALSMRARVL-YAAKDLDLASF--NYEDLADAKWKGKVCI 154


>gi|218780136|ref|YP_002431454.1| extracellular solute-binding protein family 1 [Desulfatibacillum
           alkenivorans AK-01]
 gi|218761520|gb|ACL03986.1| extracellular solute-binding protein family 1 [Desulfatibacillum
           alkenivorans AK-01]
          Length = 327

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 86/199 (43%), Gaps = 19/199 (9%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY------- 59
           Y  +LLL       +T  + + + +YT  ++    PI+  FE+ TG+K+  +Y       
Sbjct: 3   YWRILLLIVLAGGLATSASAEEVVVYTSVDRMFSEPILQKFEKDTGIKVLAMYDVEASKT 62

Query: 60  TSSIQRPPITQGSP-VDVIITKD--ETSLALNEDLLHKLPAHLIKKNSF--VLKNENKKL 114
              + R    +  P  DV    +   T   L ED+L   P   +  + F    K+++   
Sbjct: 63  VGLVNRLIAEKRRPRADVFWNSEVIRTIQLLKEDVLT--PYKSVYYDDFPTTFKDKDGYW 120

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA-P--NNISFHRLLNTMEQT 171
              +   +VL  +   I+  DLP S+ D T  +WK +++IA P     + H  +  +   
Sbjct: 121 TGFAGRARVLLINATMIQERDLPPSILDFTKPEWKGKVTIAYPLFGTTAMH--VAALYDY 178

Query: 172 PNKTVVQDFIKNITANEIL 190
                 + ++K + AN++L
Sbjct: 179 IGTEKTEAYLKGLAANDVL 197


>gi|325982326|ref|YP_004294728.1| extracellular solute-binding protein family 1 [Nitrosomonas sp.
           AL212]
 gi|325531845|gb|ADZ26566.1| extracellular solute-binding protein family 1 [Nitrosomonas sp.
           AL212]
          Length = 337

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 88/175 (50%), Gaps = 17/175 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ + + ++ P+  +F + TG+K+   YT+  +   + +       +P D++IT D 
Sbjct: 30  VVVYSARIEQLIKPMFDAFTKETGIKVK--YTTDNEGALLARLEAEGKNTPADMLITADV 87

Query: 83  TSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L  A  + LL  + + ++++N    L++       +S   + L Y+TK++  A+L  +
Sbjct: 88  GNLWAAAQKGLLKSVESGVLERNIPAHLRDPGNAWFGLSVRARTLVYNTKKVDPAEL-ST 146

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTM-----EQTPNKTVVQDFIKNITANEI 189
             DL + +W KRL +  +   +++ L  M      +   + +V+ ++ N+  + +
Sbjct: 147 YEDLADPKWSKRLCLRTSKKVYNQSLVAMMIAEHGEAETEKIVKGWVANLATDPL 201


>gi|145642008|ref|ZP_01797580.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|145273279|gb|EDK13153.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.4-21]
          Length = 332

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITIYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|261377950|ref|ZP_05982523.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria cinerea ATCC 14685]
 gi|269145811|gb|EEZ72229.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria cinerea ATCC 14685]
          Length = 331

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 75/170 (44%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTG--VKISPIYTSSIQRPPITQGS--PVDVIITKDETS 84
           + LY  Q++     +  +F + TG  VKI+   +  +      +GS  P DV  ++    
Sbjct: 24  IVLYNGQHKEATQALADAFTKSTGIKVKINSGKSDQLAGQIKEEGSRSPADVFYSEQIPP 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y ++++   DL KSV
Sbjct: 84  LATLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDSRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            +    +WK R+   P + +F   +  + +   +     ++K +  N  L
Sbjct: 144 LNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKL 193


>gi|254491495|ref|ZP_05104674.1| Bacterial extracellular solute-binding protein, putative
           [Methylophaga thiooxidans DMS010]
 gi|224462973|gb|EEF79243.1| Bacterial extracellular solute-binding protein, putative
           [Methylophaga thiooxydans DMS010]
          Length = 343

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 95/195 (48%), Gaps = 15/195 (7%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           ++ +T +  L G           + + LY+ + +S++ P+++ F + TG+K++ +   + 
Sbjct: 5   KSFFTLIPALLGLGMTPGISQAAEEVNLYSARMESLIKPLLNQFTQDTGIKVNVVSGKAD 64

Query: 63  --IQRPPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK---NSFVLKNENKKL 114
             +QR  +  + SP D+++T D   L  AL  +LL  + + ++ +   +S+  ++     
Sbjct: 65  ELLQRLKLEGRNSPADMLLTTDAGRLHRALEAELLQTVSSDILNERVPSSY--RDPEGHW 122

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSI-APNNISFHRLLNTMEQTP 172
             +S   + + Y+  R+    L  S ++ L + +W  ++ I + +NI    L+ +M    
Sbjct: 123 YGLSLRARPIMYAVDRVNPEQL--STYEQLASDEWDNKICIRSSSNIYNQSLVASMIAAD 180

Query: 173 NKTVVQDFIKNITAN 187
            +   Q + +N+ AN
Sbjct: 181 GEDTTQAWAENLVAN 195


>gi|42522628|ref|NP_968008.1| putative iron ABC transporter [Bdellovibrio bacteriovorus HD100]
 gi|39575160|emb|CAE79001.1| putative iron ABC transporter [Bdellovibrio bacteriovorus HD100]
          Length = 330

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 77/162 (47%), Gaps = 24/162 (14%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPV 74
           A + +  T  L LY+  +   + PI+  F + TG+++  ++ SS  + +   T+G  S  
Sbjct: 13  AVTVQANTAKLVLYSSYDGERLAPILQPFTQATGIQVEVVFASSTDLLKQLETEGLNSRA 72

Query: 75  DVIITKDETSLA-----------LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQV 123
           D+ + KD   +             +  +  K+P+HLI        +++K    + +  + 
Sbjct: 73  DLYLDKDIVYMGEANRKGFLQSFTSNGVTQKVPSHLI--------SDDKNWFLLFYRART 124

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLL 165
           + Y+T+++   DL K+  DL + +WK +L +  +  S++  +
Sbjct: 125 VMYNTQKVNPEDL-KTYADLGDPKWKGQLCLRTSKNSYNEAM 165


>gi|30995354|ref|NP_438271.2| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           Rd KW20]
          Length = 332

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 82/180 (45%), Gaps = 9/180 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPV 74
           AFS  N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P 
Sbjct: 16  AFSA-NSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPA 74

Query: 75  DVIITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKR 130
           DV  T+   + A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   +
Sbjct: 75  DVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTK 134

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           +   D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 135 LSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|148825628|ref|YP_001290381.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittEE]
 gi|319896538|ref|YP_004134731.1| iron-utilization periplasmic protein hfbpa [Haemophilus influenzae
           F3031]
 gi|148715788|gb|ABQ97998.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittEE]
 gi|309972773|gb|ADO95974.1| Iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae R2846]
 gi|317432040|emb|CBY80389.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3031]
          Length = 332

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|223940573|ref|ZP_03632419.1| extracellular solute-binding protein family 1 [bacterium Ellin514]
 gi|223890765|gb|EEF57280.1| extracellular solute-binding protein family 1 [bacterium Ellin514]
          Length = 320

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 12/143 (8%)

Query: 16  FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSPVD 75
           F+  F  E     + +Y  Q+++   PI   FE++TG+K+  ++ S   +   T G    
Sbjct: 28  FSAVFQAEGKDSSVIVYASQDETYADPIFKQFEKQTGIKVRAVFDSEAVK---TVGLANR 84

Query: 76  VIITKDETSLAL---NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           ++  +      +   NE+   +L   L  +N F    E      + + T+ L  +T  + 
Sbjct: 85  LLAERSHPQCDVFWSNEEFRTRL---LASENIF---RETNGWAAMGYRTRRLVVNTNLLP 138

Query: 133 IADLPKSVFDLTNAQWKKRLSIA 155
           IA  P +  D TN  W+ ++++A
Sbjct: 139 IAKAPHAFSDATNQIWRGKVALA 161


>gi|269469043|gb|EEZ80604.1| iron ABC transporter substrate-binding protein [uncultured SUP05
           cluster bacterium]
          Length = 339

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVIITKDETS 84
           +T+Y+ + + ++ P+  +F + TGVK+  +       I+R  +    +P D+ +T D  +
Sbjct: 32  VTVYSSRKEHLIKPLFEAFTKDTGVKVEYLTGKGGALIERLKLEGANTPADMFMTVDAGN 91

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L    ++DL   +    +K N    L++ +     +S   + + YST R+  ADL  +  
Sbjct: 92  LWYVGSQDLFQPVQTETLKSNIPSHLRDPDGLWTGLSVRARTIVYSTDRVNSADL-STYA 150

Query: 142 DLTNAQWKKRLSI 154
           DL+ ++WK +L +
Sbjct: 151 DLSASKWKGKLCL 163


>gi|313668878|ref|YP_004049162.1| major ferric iron binding protein [Neisseria lactamica ST-640]
 gi|313006340|emb|CBN87803.1| major ferric iron binding protein [Neisseria lactamica 020-06]
          Length = 331

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG+K+      S Q       +GS  P DV  ++    
Sbjct: 24  ITVYNGQHKEATQALADAFTRATGIKVKVNSGKSDQLAGQIKEEGSRSPADVFYSEQIPP 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            +    +WK R+   P + +F   +  + +   +     ++K +  N  L
Sbjct: 144 LNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKL 193


>gi|309378960|emb|CBX22413.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           lactamica Y92-1009]
          Length = 331

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS--PVDVIITKDETS 84
           +T+Y  Q++     +  +F   TG+K+      S Q       +GS  P DV  ++    
Sbjct: 24  ITVYNGQHKEATQALADAFTRATGIKVKVNSGKSDQLAGQIKEEGSRSPADVFYSEQIPP 83

Query: 85  LAL--NEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV
Sbjct: 84  LVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSV 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            +    +WK R+   P + +F   +  + +   +     ++K +  N  L
Sbjct: 144 LNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKL 193


>gi|294508435|ref|YP_003572493.1| Iron(III)-binding periplasmic protein [Precursor] [Salinibacter
           ruber M8]
 gi|294344763|emb|CBH25541.1| Iron(III)-binding periplasmic protein [Precursor] [Salinibacter
           ruber M8]
          Length = 360

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 77/165 (46%), Gaps = 8/165 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVDVIITKDETS 84
           L +Y+ ++++++  ++  + ++  V +   Y +  Q     Q     SP DV       +
Sbjct: 28  LVIYSGRSKALVDSLVQQYRQQADVPVRVRYGTDSQLLAALQEEGDQSPADVFWANTTGA 87

Query: 85  L--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L  A+N  LL +LP  L  + +    + N++   ++   +VLAY++  +   DLP SV D
Sbjct: 88  LGNAVNNGLLTELPDTLANRAARFTPS-NQRWTPVTTRFRVLAYNSDAVSPEDLPDSVLD 146

Query: 143 L-TNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L  + +++ R+   P   SF   +  +  T      + ++ ++ A
Sbjct: 147 LPEHEEFEGRVGWTPAYSSFQDFVTALRVTEGAETARTWLSDMQA 191


>gi|83816110|ref|YP_446499.1| extracellular solute-binding protein, putative [Salinibacter ruber
           DSM 13855]
 gi|83757504|gb|ABC45617.1| Bacterial extracellular solute-binding protein, putative
           [Salinibacter ruber DSM 13855]
          Length = 363

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 77/165 (46%), Gaps = 8/165 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVDVIITKDETS 84
           L +Y+ ++++++  ++  + ++  V +   Y +  Q     Q     SP DV       +
Sbjct: 28  LVIYSGRSKALVDSLVQQYRQQADVPVRVRYGTDSQLLAALQEEGDQSPADVFWANTTGA 87

Query: 85  L--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L  A+N  LL +LP  L  + +    + N++   ++   +VLAY++  +   DLP SV D
Sbjct: 88  LGNAVNNGLLTELPDTLANRAARFTPS-NQRWTPVTTRFRVLAYNSDAVSPEDLPDSVLD 146

Query: 143 L-TNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L  + +++ R+   P   SF   +  +  T      + ++ ++ A
Sbjct: 147 LPEHEEFEGRVGWTPAYSSFQDFVTALRVTEGAETARTWLSDMQA 191


>gi|262371220|ref|ZP_06064540.1| extracellular solute-binding protein, family 1 [Acinetobacter
           johnsonii SH046]
 gi|262313827|gb|EEY94874.1| extracellular solute-binding protein, family 1 [Acinetobacter
           johnsonii SH046]
          Length = 338

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 72/150 (48%), Gaps = 8/150 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPI 68
           LLL G      +      + LYT +   +M P++  F ++TGVK++ ++     ++R   
Sbjct: 9   LLLTGLVAFSGSWVHAAEVNLYTTREPVLMQPLLKEFSQKTGVKVNTVFIKDGLLERVKA 68

Query: 69  -TQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVL 124
             + SP DV++T D  +L   +   L  ++ + ++ K+    L+  N     +S   + +
Sbjct: 69  EGRRSPADVMLTVDFGNLVDLVESGLTQRVDSKILNKSIPGNLRAANGHWYALSMRARAV 128

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
             S  R+ ++ +  S  DL N +WK ++ I
Sbjct: 129 YVSKDRVPLSAI--SYEDLANPKWKGKICI 156


>gi|145629023|ref|ZP_01784822.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.1-21]
 gi|144978526|gb|EDJ88249.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.1-21]
          Length = 292

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|121997978|ref|YP_001002765.1| extracellular solute-binding protein [Halorhodospira halophila SL1]
 gi|121589383|gb|ABM61963.1| extracellular solute-binding protein, family 1 [Halorhodospira
           halophila SL1]
          Length = 335

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 90/199 (45%), Gaps = 18/199 (9%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           MF R I     L+ G       +     LT+Y+ +   ++ PI+  F E TG+ +   + 
Sbjct: 1   MF-RPIPVATALIAGAVLITGCDTGDDELTVYSARQDHLISPILERFTEETGISVR--FV 57

Query: 61  SSIQRPPI----TQG--SPVDVIITKDETSL--ALNEDLLHKL-PAHLIKKNSFVLKNEN 111
           +    P +     +G  +P D+++T D  +L  A   DLL +L  + L  +    L++ +
Sbjct: 58  TDDAGPLMERLKAEGERTPADILLTVDAGNLHQATENDLLARLDSSELRGRIPEHLRDPD 117

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM--- 168
            +   +S   + + YS +R+   +L  S  +L + +W+ RL +  +   +++ L  M   
Sbjct: 118 DRWFGLSVRARTIMYSPERVDPEEL-DSYANLADEKWEGRLCLRTSQQVYNQSLVAMMLH 176

Query: 169 --EQTPNKTVVQDFIKNIT 185
              +     +V+ ++ N+ 
Sbjct: 177 HEGEEETARIVEGWVDNLA 195


>gi|85713064|ref|ZP_01044100.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           baltica OS145]
 gi|85693103|gb|EAQ31065.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           baltica OS145]
          Length = 344

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 85/175 (48%), Gaps = 25/175 (14%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKDETS 84
           + +Y+ + Q+++ P++  F E+TG++++ +  +S   + R     + +P D+ +T D  +
Sbjct: 31  VNIYSSRKQALIKPLLDKFTEQTGIEVNLLTGNSDALLSRLKAEGENTPADLFLTVDAGA 90

Query: 85  L----------ALNEDLLHK-LPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           L          A++ +  HK +PAH         ++ + + + +S   + + YS  R+  
Sbjct: 91  LHRAVTADVFQAIDSEFAHKTVPAH--------FRDSDDQWVGLSLRARPIFYSPDRVDP 142

Query: 134 ADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           + L ++   L + QW+ R+ I + NNI    L+  +     +  +  + K++  N
Sbjct: 143 SQL-ENYMSLADDQWQDRICIRSSNNIYNQSLVAALLDHYGEQKIMGWAKDLVDN 196


>gi|257453940|ref|ZP_05619216.1| extracellular solute-binding protein, family 1 [Enhydrobacter
           aerosaccus SK60]
 gi|257448605|gb|EEV23572.1| extracellular solute-binding protein, family 1 [Enhydrobacter
           aerosaccus SK60]
          Length = 398

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 89/188 (47%), Gaps = 31/188 (16%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPIT-------QG 71
           A +T      LT+YT  +++ + P++ S+  +  V   PI+   +Q  P++       +G
Sbjct: 81  ASTTAAVPNQLTIYTSIDKAALEPLLTSYARQINV---PIHI--VQDEPMSILARLKAEG 135

Query: 72  --SPVDVIITKDET--SLALNEDLLH-----KLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
             SP DVI+T+D    S A+ E LL      K  AH+ ++     ++ +   + +S   +
Sbjct: 136 ANSPADVILTEDAGIFSTAVEEGLLQPFNAEKAVAHVPER----YRDPDGNWIALSSYAR 191

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA-----PNNISFHRLLNTMEQTPNKTVV 177
              Y ++ +   D+  S  DL+  +W ++L ++     PN      L+N +     + V+
Sbjct: 192 TAVYDSRVLHTNDI-SSYADLSKLKWSQKLCLSQGKYIPNQSLVVNLINNLGDKRTQEVM 250

Query: 178 QDFIKNIT 185
           Q ++ NI+
Sbjct: 251 QGWLANIS 258


>gi|192362144|ref|YP_001984073.1| putative extracellular solute-binding protein [Cellvibrio japonicus
           Ueda107]
 gi|190688309|gb|ACE85987.1| putative Bacterial extracellular solute-binding protein [Cellvibrio
           japonicus Ueda107]
          Length = 347

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 84/188 (44%), Gaps = 18/188 (9%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPIT 69
           L++ G +       T   L LYT +  +++ P++ +F ERTGVK++ ++    +     +
Sbjct: 17  LVVLGLSSLCGAVPTAGELNLYTTREPALIDPLLKAFGERTGVKVNTVFLKDGLAERVAS 76

Query: 70  QG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKN------SFVLKNENKKLMRISFDT 121
           +G  SP DV++  D  +L    DL+ K     IK        +  L++       +S   
Sbjct: 77  EGRRSPADVLMAVDFGNL---TDLVDKGVTQSIKSPVLEQTIAAPLRDAGGHWFALSLRA 133

Query: 122 QVLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
           + L Y  + +   D     +D L +A+WK ++ I      ++  L+  M     +   + 
Sbjct: 134 RTL-YVAREL---DAKAVTYDELADAKWKGKVCIRSGQHPYNTALIAHMIAKQGEARAEQ 189

Query: 180 FIKNITAN 187
           +++ + AN
Sbjct: 190 WLRGLKAN 197


>gi|134299387|ref|YP_001112883.1| extracellular solute-binding protein [Desulfotomaculum reducens
           MI-1]
 gi|134052087|gb|ABO50058.1| extracellular solute-binding protein, family 1 [Desulfotomaculum
           reducens MI-1]
          Length = 355

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 95/197 (48%), Gaps = 16/197 (8%)

Query: 6   IYTYLLLLCGF------TEAFSTEN-TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           + T +L+L G       T +  T+N     + LYTD++      +   F + TG+K++ +
Sbjct: 12  VITAMLVLSGCSASNNNTASKETDNKENGVINLYTDRHYDTDQALFDLFTKETGIKVNVV 71

Query: 59  YTSS---IQR-PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNEN 111
              S   I+R     + +  D++IT D   L  A  ++LL    +  + KN    L++++
Sbjct: 72  KAESDELIERLAREGKDTKADLLITADAGRLYRAKEKELLQTTSSETLFKNVPENLRDKD 131

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQ 170
            +   ++   +V+ Y+  R+  A L  +  DLT+A+WK ++ + + NNI    LL +   
Sbjct: 132 NQWFGLTKRARVIVYAKDRVDPAQLS-TYEDLTDAKWKGKVLVRSANNIYNQSLLASFIA 190

Query: 171 TPNKTVVQDFIKNITAN 187
              +   + + K++ AN
Sbjct: 191 LNGEDQAKAWAKDLVAN 207


>gi|51893886|ref|YP_076577.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51857575|dbj|BAD41733.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 365

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 66/137 (48%), Gaps = 9/137 (6%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEER-----TGVKISPIYTSSI-QRPPITQGSPVDVII-- 78
           K L +YT ++QS++  ++  FEE+       V++ P+    I +R    + +P   I   
Sbjct: 47  KRLVIYTGRDQSIIDLMVAKFEEKYPEYKGNVEVLPMGAQEIMERVRAEKANPQGDIWWG 106

Query: 79  -TKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
            T+   SLA+ E LL K+      K +   K+            +V+ Y+ + I  ++LP
Sbjct: 107 GTQQALSLAVKEGLLAKINPEFASKIADGYKDPEGHWYGEMLLPEVIMYNKEMISESELP 166

Query: 138 KSVFDLTNAQWKKRLSI 154
           K   DL +A+WK ++ I
Sbjct: 167 KDWDDLLDAKWKDQIII 183


>gi|255600161|ref|XP_002537397.1| Iron(III)-binding periplasmic protein precursor, putative [Ricinus
           communis]
 gi|223516491|gb|EEF24985.1| Iron(III)-binding periplasmic protein precursor, putative [Ricinus
           communis]
          Length = 214

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V AY  +++    LPKS+ DL +  WK R   AP    F  +++ + Q   +  
Sbjct: 5   IAARSTVFAYDKRKLTEDKLPKSMLDLADPAWKGRWGAAPAGADFQAIVSALLQLKGEEA 64

Query: 177 VQDFIKNITANEILTKYK 194
              ++K +  N   T YK
Sbjct: 65  TAAWLKGLKDNA--TPYK 80


>gi|85703671|ref|ZP_01034775.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
 gi|85672599|gb|EAQ27456.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
          Length = 338

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 85/170 (50%), Gaps = 10/170 (5%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVIITKD 81
            + + LY+ ++      +  +F E TG+KI+ I       I+R       SP DV +T D
Sbjct: 22  AQEVNLYSSRHYDSDNALYDAFTEETGIKINRIEGKEAELIERMKAEGANSPADVFMTVD 81

Query: 82  --ETSLALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
               S A++E LL    + LI+ N +  L++ +     +S  ++++ Y+  R+     P+
Sbjct: 82  VGNISRAVDEGLLQPFDSDLIETNVAANLRHPDNLWTGLSQRSRIIFYAKDRVDAP--PQ 139

Query: 139 SVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +L + ++K ++ I + +N+    LL ++ +   + V +D+ + I AN
Sbjct: 140 TYEELADPKYKGQICIRSSSNVYNQSLLASIIEVHGEEVAKDWAEGIVAN 189


>gi|325291841|ref|YP_004277705.1| iron ABC transporter substrate-binding protein [Agrobacterium sp.
           H13-3]
 gi|325059694|gb|ADY63385.1| iron ABC transporter, substrate binding protein [Agrobacterium sp.
           H13-3]
          Length = 338

 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPITQG--SPVDVIITKDETSL 85
           L +YT +  +++ P++ SF   +GVK++ ++    +    +++G  SP DV++T D  +L
Sbjct: 26  LNIYTTREPALIQPLLESFTASSGVKVNTVFLKDGLAERVLSEGASSPADVLMTVDAGNL 85

Query: 86  ALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL  K     ++  +        L++       +S   +VL Y+ K + +A    +
Sbjct: 86  V---DLAEKGVTQPVESETLNKAIPAELRDAKGHWFALSMRARVL-YAAKDLDLASF--N 139

Query: 140 VFDLTNAQWKKRLSI 154
             DL +A+WK ++ I
Sbjct: 140 YEDLADAKWKGKICI 154


>gi|145637674|ref|ZP_01793328.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittHH]
 gi|145269134|gb|EDK09083.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittHH]
          Length = 332

 Score = 43.5 bits (101), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|145631531|ref|ZP_01787299.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|260581987|ref|ZP_05849782.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           NT127]
 gi|144982876|gb|EDJ90393.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|260094877|gb|EEW78770.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           NT127]
          Length = 332

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|68248708|ref|YP_247820.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           86-028NP]
 gi|145639598|ref|ZP_01795202.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittII]
 gi|148827241|ref|YP_001291994.1| iron-utilization periplasmic protein FbpA [Haemophilus influenzae
           PittGG]
 gi|229847064|ref|ZP_04467170.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           7P49H1]
 gi|260580598|ref|ZP_05848425.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           RdAW]
 gi|2507358|sp|P35755|FBPA_HAEIN RecName: Full=Iron-utilization periplasmic protein; AltName:
           Full=Fe(3+)-binding protein; AltName:
           Full=Iron-regulated 40 kDa protein; AltName: Full=Major
           ferric iron-binding protein; Short=MIRP; Flags:
           Precursor
 gi|68056907|gb|AAX87160.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           86-028NP]
 gi|145271389|gb|EDK11302.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittII]
 gi|148718483|gb|ABQ99610.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittGG]
 gi|229810148|gb|EEP45868.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           7P49H1]
 gi|260092660|gb|EEW76596.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           RdAW]
 gi|301168756|emb|CBW28347.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           10810]
 gi|309750486|gb|ADO80470.1| Iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae R2866]
          Length = 332

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|257455483|ref|ZP_05620716.1| ABC transporter, iron binding protein [Enhydrobacter aerosaccus
           SK60]
 gi|257447108|gb|EEV22118.1| ABC transporter, iron binding protein [Enhydrobacter aerosaccus
           SK60]
          Length = 329

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 89/177 (50%), Gaps = 22/177 (12%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI------SP 57
           + + T+ +L+   T A +++     L +Y+ +  +++ PI+  +E++TGVKI      + 
Sbjct: 2   KRLMTFGMLMGAVTPALASD-----LVIYSARADNLLKPIVAKYEQQTGVKIKLVNDKAG 56

Query: 58  IYTSSIQRPPITQGS--PVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENK 112
           +    I+     +G+  P D++IT D  +L  A  E++L  + + +++ N     ++   
Sbjct: 57  VLIEKIK----AEGANTPADLLITVDGGNLWQAAQENILRPVNSKVLETNIPPQFQDPQN 112

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTM 168
           +   +S   + + Y+  +I  + L  +  DL+  +WK +L +   +N+    L+ TM
Sbjct: 113 RWFGMSVRARTIFYNPTKINPSQL-STYADLSTPKWKGKLCLRTSDNVYNQSLVATM 168


>gi|218671223|ref|ZP_03520894.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli GR56]
          Length = 204

 Score = 43.5 bits (101), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  T V AY   ++    LPKS+ DL +  WK R   AP    F  ++  + Q   +  
Sbjct: 19  IAARTTVFAYDKTKLTEDKLPKSMLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGEDA 78

Query: 177 VQDFIKNITANEILTKYK 194
            + ++K +  N   T YK
Sbjct: 79  TKAWLKGLKDN--ATPYK 94


>gi|145579974|pdb|2O69|A Chain A, Crystal Structure Of Haemophilus Influenzae N193l Mutant
           Fbpa
          Length = 309

 Score = 43.1 bits (100), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|38492941|pdb|1QW0|A Chain A, Crystal Structure Of Haemophilus Influenzae N175l Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score = 43.1 bits (100), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|6573533|pdb|1D9V|A Chain A, Haemophilus Influenzae Ferric-Binding Protein Apo Form
 gi|157832046|pdb|1MRP|A Chain A, Ferric-Binding Protein From Haemophilus Influenzae
 gi|306991947|pdb|3OD7|A Chain A, Haemophilus Influenzae Ferric Binding Protein A -Iron
           Loaded
 gi|306991948|pdb|3ODB|A Chain A, Haemophilus Influenzae Ferric Binding Protein A -Iron
           Loaded -Open Conformation
          Length = 309

 Score = 43.1 bits (100), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 77/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 171


>gi|306991649|pdb|3KN8|A Chain A, Crystal Structure Of Haemophilus Influenzae Y196a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score = 43.1 bits (100), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score = 43.1 bits (100), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|18977890|ref|NP_579247.1| thiamin-binding periplasmic protein precursor [Pyrococcus furiosus
           DSM 3638]
 gi|18893652|gb|AAL81642.1| thiamin-binding periplasmic protein precursor [Pyrococcus furiosus
           DSM 3638]
          Length = 346

 Score = 42.7 bits (99), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 9/137 (6%)

Query: 27  KYLTLYT-DQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSP-VDVIITK 80
           K LT+Y  D  +  +  +I  FEE   VK++ +   S    + R  I + +P  DV++  
Sbjct: 28  KVLTVYAYDSLEYWLKEVIPEFEEEYNVKVNLVLVGSTGELVNRLIIEKDNPKADVVVGI 87

Query: 81  DET--SLALNEDLLHKL-PAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D T  S A+   +L K  P ++     ++++  + +     FD   +A++ +   I D P
Sbjct: 88  DNTFMSKAIKAGVLEKYKPRNVDVIPQWIIEKFDPEFYLTPFDYGYIAFNYRTDLIQDYP 147

Query: 138 KSVFDLTNAQWKKRLSI 154
           KS+ DLT  +WK ++ I
Sbjct: 148 KSLDDLTKPEWKGKIII 164


>gi|256823674|ref|YP_003147637.1| family 1 extracellular solute-binding protein [Kangiella koreensis
           DSM 16069]
 gi|256797213|gb|ACV27869.1| extracellular solute-binding protein family 1 [Kangiella koreensis
           DSM 16069]
          Length = 359

 Score = 42.7 bits (99), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 83/181 (45%), Gaps = 13/181 (7%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPV 74
           A  + +  K + +YT + + ++ P    F   TG++I+ I  S    I R     + +P 
Sbjct: 40  ATQSNDNNKEIVVYTSRKEHLVKPFFEQFTAETGIEINYITDSEAALISRLKAEGERTPA 99

Query: 75  DVIITKDETS--LALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV+IT D  +  LA  ED+L  + +  ++      L++       ++   + + YST+R+
Sbjct: 100 DVLITVDAGNLWLATQEDVLQPIESQALEAAIPDSLQDPENHWFGLTVRARTVVYSTERV 159

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM-----EQTPNKTVVQDFIKNITA 186
           K  +L  +   L   QW  RL +  +   +++ L  M      +   + +V+ ++ N+  
Sbjct: 160 KPEEL-TTYEALGEEQWNGRLCLRTSKKVYNQSLVAMLIARYGEEKTQQIVESWVANLAT 218

Query: 187 N 187
           +
Sbjct: 219 D 219


>gi|29726721|pdb|1NNF|A Chain A, Crystal Structure Analysis Of Haemophlius Influenzae
           Ferric- Ion Binding Protein H9q Mutant Form
          Length = 309

 Score = 42.7 bits (99), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q +     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQQKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|93006552|ref|YP_580989.1| extracellular solute-binding protein [Psychrobacter cryohalolentis
           K5]
 gi|92394230|gb|ABE75505.1| extracellular solute-binding protein, family 1 [Psychrobacter
           cryohalolentis K5]
          Length = 374

 Score = 42.4 bits (98), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/184 (18%), Positives = 89/184 (48%), Gaps = 21/184 (11%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-------TQG 71
           A S +  T  +T+Y+ +N+ ++ P++  + E+TGVK+  +   + +  P+        Q 
Sbjct: 59  AASADGQT--VTIYSSRNEQLIKPLLDRYTEQTGVKVELV---TDKDGPLMARLQAEGQN 113

Query: 72  SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLMRISFDTQVLAYST 128
           +P D+++T D  +L  A  + LL  + + +++ N     ++   +   +S   + + Y  
Sbjct: 114 TPADMLLTVDAGNLWQAAGQGLLQPVASSVLEANVPAKYRDPEGRWTGLSLRARTIFYDP 173

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKN 183
            ++  AD   +  DL + +WK +L +  +   +++     ++  +     + V++ ++ N
Sbjct: 174 SKVS-ADQLSTYADLADPKWKGKLCLRTSKKVYNQSLVASMMEHLGAEKTEAVIRGWVAN 232

Query: 184 ITAN 187
           +  +
Sbjct: 233 LATD 236


>gi|1498595|gb|AAB66501.1| periplasmic iron repressible protein [Aggregatibacter
           actinomycetemcomitans]
          Length = 332

 Score = 42.4 bits (98), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 77/170 (45%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV  ++    
Sbjct: 25  ITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYSEQTAP 84

Query: 85  LA-LNE-DLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 85  FAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSV 144

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
                 +WK ++   P + +F   +  + +   +    D++K +  N  L
Sbjct: 145 LVHATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKSALDWLKGLKENGKL 194


>gi|145579975|pdb|2O6A|A Chain A, Crystal Structure Of The Haemophilus Influenzae E57a
           Mutant Fbpa
          Length = 309

 Score = 42.4 bits (98), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 76/170 (44%), Gaps = 8/170 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T    +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTAQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 171


>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score = 42.4 bits (98), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q +     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQAKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|57505756|ref|ZP_00371682.1| iron transport protein [Campylobacter upsaliensis RM3195]
 gi|57016029|gb|EAL52817.1| iron transport protein [Campylobacter upsaliensis RM3195]
          Length = 334

 Score = 42.4 bits (98), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 79/154 (51%), Gaps = 18/154 (11%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           + L L GF+   + E     L +Y+ ++      II  FEE+TG+KI+     +   I+R
Sbjct: 5   FSLCLLGFSLLGAAE-----LNIYSARHYDADFQIIKKFEEKTGIKINHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISF 119
             +    SP D+ IT D ++L  A N  LL  + +  ++K  F+   L++++KK   I+ 
Sbjct: 60  LSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEK--FIPAHLRDKDKKWFAITK 117

Query: 120 DTQVLAYS-TKRIKIADLPKSVFDLTNAQWKKRL 152
             +++AY+    I I+ + K+  DL   ++K  +
Sbjct: 118 RARIIAYNKNANIDISKM-KNYEDLAKPEFKGEI 150


>gi|229845490|ref|ZP_04465619.1| iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 6P18H1]
 gi|619398|gb|AAB32110.1| HitA [Haemophilus influenzae]
 gi|229811593|gb|EEP47293.1| iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 6P18H1]
          Length = 332

 Score = 42.4 bits (98), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAAAAVAKAFEQETGIKVTLNSGKSAQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWVALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|289207484|ref|YP_003459550.1| extracellular solute-binding protein family 1 [Thioalkalivibrio sp.
           K90mix]
 gi|288943115|gb|ADC70814.1| extracellular solute-binding protein family 1 [Thioalkalivibrio sp.
           K90mix]
          Length = 345

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 80/165 (48%), Gaps = 16/165 (9%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPI 68
           L G + A   E     + LY+ + ++++ P++  F E TG+K++ +  S+   +QR    
Sbjct: 22  LVGCSPADEDE-----VNLYSARQENLIQPLLEQFTEETGIKVNLVTGSADSLLQRLRHE 76

Query: 69  TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLA 125
            + SP DV+IT D   L  A    +L  + +  + +N     ++   +   +S   + + 
Sbjct: 77  GRNSPADVLITVDAGRLHHAQQAGVLQAVESDTLNENIPERYRDPEGEWYGLSLRARPIL 136

Query: 126 YSTKRIKIADLPKSVFD-LTNAQWKKRLSI-APNNISFHRLLNTM 168
           Y   R+   DL  S ++ LT+ QW+ R+ I + +N+    L+  M
Sbjct: 137 YHKDRVDPDDL--STYEALTDEQWEGRICIRSSDNVYNQSLVAAM 179


>gi|118602697|ref|YP_903912.1| extracellular solute-binding protein [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567636|gb|ABL02441.1| extracellular solute-binding protein, family 1 [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 339

 Score = 42.0 bits (97), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 84/170 (49%), Gaps = 13/170 (7%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPI-TQGSPVDVIITKDETS 84
           +T+Y+ + + ++ P+  SF + TG+K++ +    ++ I+R  +  + +  D+ +T D  +
Sbjct: 32  ITVYSSRKEHLIKPLFESFTKDTGIKVTYLTGKGSALIERLKLEGKNTKADMFMTVDAGN 91

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A  +DL   +    +K N    L++       +S   + + YST+R+   DL  +  
Sbjct: 92  LWYAATQDLFQAVQTQTLKSNIPSHLRDPKGLWTGLSVRARTIVYSTERVNPTDLS-TYE 150

Query: 142 DLTNAQWKKRLSI-APNNISFHRLLNTM--EQTPNKT--VVQDFIKNITA 186
           +L + +W  RL + +   I    L+ +M   Q  NK   ++  ++ N+ A
Sbjct: 151 NLADTKWSGRLCLRSSKKIYTKSLVASMIYHQGKNKVGDIISGWVNNLAA 200


>gi|220908880|ref|YP_002484191.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           7425]
 gi|219865491|gb|ACL45830.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7425]
          Length = 353

 Score = 42.0 bits (97), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 86/176 (48%), Gaps = 11/176 (6%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG--SPVD 75
           + +  ++ L LY+ ++      I  SF ++TG+K++ +   +   I+R   ++G  SP D
Sbjct: 30  TAQTRSQVLNLYSARHYDTDTAIYASFTQKTGIKVNLVEADADKLIERIK-SEGANSPAD 88

Query: 76  VIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           V+IT D   L  A    +L  + + ++ +     L++        S   +V+ Y+  R+K
Sbjct: 89  VLITVDAGRLWRAQQAGILQPVSSRVLNQAIPAELRDPKGFWFGFSRRARVIMYNKDRVK 148

Query: 133 IADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            ++L  +  DL N++W+ RL S   +++    L  ++      +  + +++ + AN
Sbjct: 149 PSEL-STYEDLANSKWRGRLISRTSSHVYNQSLTGSVLAADGASRTEQWVRGLVAN 203


>gi|188587480|ref|YP_001919025.1| extracellular solute-binding protein family 1 [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179352167|gb|ACB86437.1| extracellular solute-binding protein family 1 [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 360

 Score = 42.0 bits (97), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 62/143 (43%), Gaps = 8/143 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR-PP 67
           ++L  CG     S       L +Y+ +N+  +  ++  F E TG+++  ++ +  Q+   
Sbjct: 25  FMLTGCG-----SGGEQADELVVYSARNERFVNELLDKFTEDTGIEVKALHGADPQQIEE 79

Query: 68  ITQGSPVDVIITKDETSLA-LNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
                  D+ I+ D  +L  L+E  LL       I+      + EN     IS  ++   
Sbjct: 80  EANNVQADIFISNDLGALGYLDEQGLLQGSEPEGIESIPENFRAENNAFFAISLRSRGFI 139

Query: 126 YSTKRIKIADLPKSVFDLTNAQW 148
           Y+   I   D+P S  DL +++W
Sbjct: 140 YNKDMISEEDMPSSGEDLFDSKW 162


>gi|187478416|ref|YP_786440.1| ABC transporter substrate-binding protein [Bordetella avium 197N]
 gi|115423002|emb|CAJ49532.1| ABC transporter, substrate-binding protein [Bordetella avium 197N]
          Length = 347

 Score = 42.0 bits (97), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 90/182 (49%), Gaps = 22/182 (12%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--S 72
           T+A + E     ++LYT +   ++ P++ +F + TG+K++ ++     ++R    +G  S
Sbjct: 24  TQAGAAEE----VSLYTTREPKLIQPLLDAFTKDTGIKVNTVFVKDGLLERVK-AEGDKS 78

Query: 73  PVDVIITKDETSLALNEDLLHKLPAHLIKK---NSFV---LKNENKKLMRISFDTQVLAY 126
           P DV++T D  +L    DL+       +K    NS +   L+  + K   +S   +VL Y
Sbjct: 79  PADVLMTVDIGNLI---DLVDGGVTQAVKSDTLNSVIPANLRGADGKWYALSLRDRVL-Y 134

Query: 127 STKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNIT 185
           + K +K+  +  S  DL + +WK ++ I      ++  L+ +M         + +++++ 
Sbjct: 135 AEKDLKLDKI--SYEDLADPKWKGKVCIRSGQHPYNTALIASMIAHDGAEATEKWLRSVK 192

Query: 186 AN 187
           AN
Sbjct: 193 AN 194


>gi|88608833|ref|YP_505908.1| iron-binding protein [Neorickettsia sennetsu str. Miyayama]
 gi|88601002|gb|ABD46470.1| iron-binding protein [Neorickettsia sennetsu str. Miyayama]
          Length = 335

 Score = 41.6 bits (96), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQG--SPVDVIITKDET 83
           + +Y+ + + ++  +  SF ERTG+K++ I    T  I R   ++G  +  DV +  D  
Sbjct: 24  VNIYSSRKEEMVKDLFASFAERTGIKVNYITDDATKLISRMK-SEGVNTSADVFLAADVI 82

Query: 84  SLALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +LAL E + L +  +  + +N+   +  +     ++    V+ YS +R+  +++ ++  D
Sbjct: 83  NLALAEAEGLLQCISSTVLENALPPELRDCYWFGLTRRMAVIVYSKERVDPSEI-RNYED 141

Query: 143 LTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIKNITAN 187
           L +++WK RL +  +N  ++R L+ ++     +   + +IK I  N
Sbjct: 142 LADSKWKDRLLLRSSNSPYNRSLIASVILANGEEKAEAWIKGIVRN 187


>gi|294637654|ref|ZP_06715933.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Edwardsiella tarda ATCC 23685]
 gi|291089209|gb|EFE21770.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Edwardsiella tarda ATCC 23685]
          Length = 349

 Score = 41.6 bits (96), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 84/189 (44%), Gaps = 23/189 (12%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPIT 69
           LL G + A      ++ LTLYT +   ++ P++  + +++GV+++ +Y     ++R    
Sbjct: 20  LLFGLS-ALPAGAASESLTLYTTREPGLIKPLLEGWSQQSGVQVNTVYIKDGMLERLKAE 78

Query: 70  QG-SPVDVIITKDETSLALNEDLLHKL------PAHLIKKNSFVLKNENKKLMRISFDTQ 122
              SP D+++T D  +L    DL+          A LI+     L+  + +   +S   +
Sbjct: 79  GANSPADLLMTVDAGNLL---DLVEAGVTQPVNSATLIQAIPANLRGSDNQWFALSMRAR 135

Query: 123 VLAYSTKRIKIADLPKSVF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQ 178
           VL Y  K     DLP       DL   +W KR+ +      ++  L+  M     +   +
Sbjct: 136 VL-YIAK-----DLPSGAIQYEDLAKPEWSKRICMRSGQHPYNTALVAAMIAHQGEAKTE 189

Query: 179 DFIKNITAN 187
            +++ + AN
Sbjct: 190 QWLRALKAN 198


>gi|121612406|ref|YP_999899.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167004863|ref|ZP_02270621.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87250366|gb|EAQ73324.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 334

 Score = 41.6 bits (96), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 81/154 (52%), Gaps = 18/154 (11%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           +L+ L  F+   ++E     L +Y+ ++      II  FEE+TG+K++     +   I+R
Sbjct: 5   FLMFLTAFSFLGASE-----LNIYSARHYDADFEIIKKFEEKTGIKVNHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISF 119
             +    SP D+ IT D ++L  A N  LL  + +  +++  F+   L++++K+   I+ 
Sbjct: 60  LSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITK 117

Query: 120 DTQVLAYS-TKRIKIADLPKSVFDLTNAQWKKRL 152
             +++AY+    I I+ + K+  DL  A++K  +
Sbjct: 118 RARIIAYNKNANIDISKM-KNYEDLARAEFKGEI 150


>gi|144897381|emb|CAM74245.1| Bacterial extracellular solute-binding protein, family 1
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 338

 Score = 41.6 bits (96), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 89/190 (46%), Gaps = 10/190 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ- 64
           +++ L L      A  T +  + + +Y+ +   ++ P++ +F + +G+K++ +  +  Q 
Sbjct: 3   LFSRLALTVAACMAAGTVSAAE-VNVYSARKDHLLKPVLDAFTQSSGIKVNLLSANETQL 61

Query: 65  -RPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRIS 118
                ++G  SP D+ IT D   L  A    +L  + + ++ KN      +       +S
Sbjct: 62  LERLKSEGKDSPADLFITTDVAHLHAARVAGILAPVQSAVLAKNIPAQYHDPQGYWYGLS 121

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVV 177
              +V+ Y+  R+K ADL  +  DL  A WK R+ +  ++ ++++ LL  +         
Sbjct: 122 ARARVIFYAKDRVKPADL-STYEDLATATWKGRICVRSSSSTYNQSLLGGLIAVMGPEKA 180

Query: 178 QDFIKNITAN 187
           + + K IT N
Sbjct: 181 EAWAKGITDN 190


>gi|145579973|pdb|2O68|A Chain A, Crystal Structure Of Haemophilus Influenzae Q58l Mutant
           Fbpa
          Length = 309

 Score = 41.6 bits (96), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETS 84
           +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   +
Sbjct: 2   ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTELTAT 61

Query: 85  LA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            A L+E  LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV
Sbjct: 62  FADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSV 121

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            D    +WK ++     + +F   +  + +     V  +++K +  N
Sbjct: 122 LDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 168


>gi|149927268|ref|ZP_01915524.1| ABC transporter, iron binding protein [Limnobacter sp. MED105]
 gi|149823982|gb|EDM83205.1| ABC transporter, iron binding protein [Limnobacter sp. MED105]
          Length = 338

 Score = 41.2 bits (95), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 81/165 (49%), Gaps = 11/165 (6%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPI 68
           +LL G  +A   +   + +T+Y+ + + ++ P +  + + TGVKI+ +     S+     
Sbjct: 12  VLLPGLAQA---QKKPEEVTVYSSRIEQLLKPTLDQYTQETGVKINLLTDRGGSLTERLN 68

Query: 69  TQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQV 123
            +G  SP DV+IT D  +L  A    LL K+ + ++  N    L++  ++   +S   + 
Sbjct: 69  AEGKSSPADVLITVDMGNLWNAAERGLLRKMDSPVLNANVPDYLRDPGQRWYGLSKRERT 128

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
           + Y+  R+   +L  +  DL   +WK +L +  +  ++ + L  M
Sbjct: 129 IFYAAGRVDPKNL-STYEDLAQPKWKGKLCLRTSKQTYTQSLVAM 172


>gi|88855885|ref|ZP_01130547.1| iron(III) ABC transporter, periplasmic-binding protein [marine
           actinobacterium PHSC20C1]
 gi|88814752|gb|EAR24612.1| iron(III) ABC transporter, periplasmic-binding protein [marine
           actinobacterium PHSC20C1]
          Length = 340

 Score = 41.2 bits (95), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 76/179 (42%), Gaps = 10/179 (5%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI--SPIYTSSIQRPPITQG- 71
           G  E  S E     L +Y  Q++ +    +  F  +TG+++       S +    + +G 
Sbjct: 25  GAVEGASAE----ALVVYNAQHEKLAEEWVEEFTAQTGIEVVLRNGGDSELSNQLVAEGD 80

Query: 72  -SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            S  DV +T++  +++L  N  L   +    +       +  +     I+  + V  Y+ 
Sbjct: 81  ASRADVFLTENSPAMSLVENAGLFAPVDPATLDLVPEKYRPASGMWTGIAARSAVFVYNP 140

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           + +  ++LP S+ DL +  WK +   AP+   F  +++ + +T       +++  +  N
Sbjct: 141 ELLDESELPSSILDLQSPSWKGKWGGAPSGADFQAIISAILETQGPEATAEWLTGMKDN 199


>gi|254796405|ref|YP_003081241.1| iron-binding protein [Neorickettsia risticii str. Illinois]
 gi|254589642|gb|ACT69004.1| iron-binding protein [Neorickettsia risticii str. Illinois]
          Length = 334

 Score = 40.8 bits (94), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 85/166 (51%), Gaps = 9/166 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQG--SPVDVIITKDET 83
           + +Y+ + + ++  +  SF ERTG+K++ I    T  I R   ++G  +  DV +  D  
Sbjct: 23  VNIYSSRKEEMVKELFTSFTERTGIKVNYITDDATKLISRMK-SEGVNTSADVFLAADVV 81

Query: 84  SLALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           +LAL E + L +  +  I +N+      +     ++    ++ YS +R+  +D+ ++  D
Sbjct: 82  NLALAEAEGLLQCISSAILENALSPDLRDCYWFGLTRRMALIVYSKERVDPSDI-RNYED 140

Query: 143 LTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIKNITAN 187
           L +++WK RL +  +N  +++ L+ ++     +   + +IK I  N
Sbjct: 141 LADSKWKDRLLLRSSNSPYNQSLIASLILANGEEKAEAWIKGIVRN 186


>gi|328949603|ref|YP_004366938.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328449927|gb|AEB10828.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 355

 Score = 40.8 bits (94), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 80/183 (43%), Gaps = 8/183 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPI 68
           +LL G   A +     + L +Y+ +++ ++ P++  FE +TG+++   Y   + +     
Sbjct: 7   VLLTGILAASAFSYAAEELVVYSGRSEVLVEPLVERFEAQTGIRVKVRYGRDAELLATLA 66

Query: 69  TQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +G  SP D+       +L  A+NE LL  L    +          + + + ++   +VL
Sbjct: 67  EEGARSPADLFWANTAGALGAAVNEGLLAPL-PEELLALPEAFTPSSGRWVPLTARFRVL 125

Query: 125 AYSTKRIKIADLPKSVFDLT-NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKN 183
           AY+ + +    LP+SV DL    +   R+   PN  SF   +  M           +++ 
Sbjct: 126 AYNPEVLSAEALPESVMDLPKRTELAGRIGWTPNYSSFQDFITAMRHLYGPEATLKWLEG 185

Query: 184 ITA 186
           + A
Sbjct: 186 MKA 188


>gi|302386898|ref|YP_003822720.1| extracellular solute-binding protein family 1 [Clostridium
           saccharolyticum WM1]
 gi|302197526|gb|ADL05097.1| extracellular solute-binding protein family 1 [Clostridium
           saccharolyticum WM1]
          Length = 354

 Score = 40.8 bits (94), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 56/135 (41%), Gaps = 11/135 (8%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ----------RPPITQGSPVDVII 78
           L +YT Q + +  P++  FEERTG+ +  + T S++           P    G   DVI 
Sbjct: 43  LVIYTVQEKEICEPVVKEFEERTGLNVK-VETGSVEDLLRTLEDSTGPYGDAGVTWDVIF 101

Query: 79  TKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
                +L   ++      +  I   +   ++ + K    S    V+ Y+T  +   ++P 
Sbjct: 102 GVGIETLEEKKEYWQAYESSEIPSIAGAFRSGDHKWTGFSACPLVIMYNTNVVTYREVPA 161

Query: 139 SVFDLTNAQWKKRLS 153
               L   +WK R++
Sbjct: 162 GWTSLLEPRWKGRVA 176


>gi|301165586|emb|CBW25157.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Bacteriovorax marinus SJ]
          Length = 332

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 83/173 (47%), Gaps = 21/173 (12%)

Query: 5   TIYTYLLLLCGF-TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           T+ T+LL    F T  F+ ++ T Y     DQ Q+V  P    F ERTG++I  +   S 
Sbjct: 4   TLKTFLLAFVLFSTNVFAAKSLTIYSVYPGDQLQAVFKP----FTERTGIEIKVVSGKSK 59

Query: 63  -----IQRPPITQGSPVDVIITKDET--SLALNEDLLHKLPAHLIKKN---SFVLKNENK 112
                I+   +   +  D+ + KD    +LA NE +     + L++KN   +F+  N+N 
Sbjct: 60  DLIKRIKEEGVN--TEADLHLDKDLAYHTLATNEGIYQPFNSKLVEKNVPANFIETNKN- 116

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLL 165
               I + ++++ Y+   +  ++L  +   L + +W+ RL +  +  S+ + L
Sbjct: 117 -WFTIFYRSRLIMYNKNTVSRSEL-STYSQLASKKWQGRLCVRTSGSSYTQSL 167


>gi|14591156|ref|NP_143232.1| thiamin-binding periplasmic protein precursor [Pyrococcus
           horikoshii OT3]
 gi|3257772|dbj|BAA30455.1| 347aa long hypothetical thiamin-binding periplasmic protein
           precursor [Pyrococcus horikoshii OT3]
          Length = 347

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYT-DQNQSVMLPIIHSFEERTGVKISPIYTSS----IQ 64
           +LL+ G       E  T  LT+Y  D  +  +  +I  FE+   VK++ +   S    + 
Sbjct: 14  ILLVAGCIGGKGEEEKT--LTVYAYDSLEYWLKEVIPEFEKEYNVKVNLVLVGSTGELVN 71

Query: 65  RPPITQGSP-VDVIITKDETSLA--LNEDLLHKL-PAHLIKKNSFVLKNENKKLMRISFD 120
           R  + + +P  DV++  D T LA  L+  +L    P ++ +   ++++  +     I FD
Sbjct: 72  RLILEKDNPQADVVVGIDNTFLAKALSAGVLDTYKPRNIDELYPWLVEKFDPTYHLIPFD 131

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
              LA++ +   + + PKS+ DL N +WK ++ I
Sbjct: 132 YGFLAFNYRTDMVKEPPKSLDDLLNEKWKGKIII 165


>gi|242281008|ref|YP_002993137.1| extracellular solute-binding protein family 1 [Desulfovibrio
           salexigens DSM 2638]
 gi|242123902|gb|ACS81598.1| extracellular solute-binding protein family 1 [Desulfovibrio
           salexigens DSM 2638]
          Length = 333

 Score = 40.4 bits (93), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 79/161 (49%), Gaps = 21/161 (13%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVIITKDETS 84
           + +Y+ + + ++ P+  ++   TGVK+  I   +   ++R       +P D+ IT D  +
Sbjct: 26  VVVYSARKEHLIKPLFDAYTAETGVKVKYITGKAGALLERIKAEGANTPADLFITVDAGN 85

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A NE +L  + +  ++KN    L++   +   +S   + + Y+  ++   +L  S +
Sbjct: 86  LWHAANEGVLAPVKSETLEKNVPAHLRDPENRWAGLSVRARTIVYNKDKVSPEEL--STY 143

Query: 142 D-LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
           + L +++WK RL           LL T ++  N+++V  FI
Sbjct: 144 EALGDSKWKGRL-----------LLRTSKKVYNQSLVASFI 173


>gi|83945632|ref|ZP_00957978.1| iron transport system substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
 gi|83850998|gb|EAP88857.1| iron transport system substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
          Length = 350

 Score = 40.4 bits (93), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 80/194 (41%), Gaps = 29/194 (14%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPP 67
           L  C  + + S E     + +YT ++ +    +  +F E TG++++ I       I+R  
Sbjct: 20  LSACNPSGSSSGEGV---VNVYTARHYASDDALYEAFTEHTGIEVNVIEAPGDLLIERVR 76

Query: 68  ITQG-SPVDVIITKDETSLALN------------EDLLHKLPAHLIKKNSFVLKNENKKL 114
                S  DV+IT D   L               E +L  +PA+L        +  +   
Sbjct: 77  ADGDRSQADVVITVDAGRLWRADEAGLFQPAPELEGVLANVPANL--------RQPDGDW 128

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
              S   +V+AY+  R+  +++  S  DLT+ QW+ R+ + + NN+    LL  M     
Sbjct: 129 FGFSKRVRVIAYAKDRVDPSEI-SSFEDLTDPQWRGRICVRSSNNVYNQSLLAAMVAQDG 187

Query: 174 KTVVQDFIKNITAN 187
               + + + I  N
Sbjct: 188 AEAAEAWARGIVEN 201


>gi|126725354|ref|ZP_01741196.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacterales bacterium HTCC2150]
 gi|126704558|gb|EBA03649.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacterales bacterium HTCC2150]
          Length = 335

 Score = 40.4 bits (93), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 79/166 (47%), Gaps = 8/166 (4%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-TQG--SPVDVIITKDETSL 85
           + +Y+ +   ++ P+I  F   TG+K++  + +   R  +  +G  SP DV++T D + L
Sbjct: 24  VNVYSHRQPDLIQPLIDGFTAETGIKVNVAFLAKGMRERLAAEGSRSPADVVMTVDISRL 83

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           A  ++  L   + + ++  N     ++   +   ++   +V+  S  R+   ++  +  D
Sbjct: 84  AEVVDAGLTQAVTSDVLAANIPAEFRDPGNQWFGLTTRARVIYASRDRVAEGEV-TTYED 142

Query: 143 LTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
           LT+ +W  R+       S++  L + +     + V  D++K + AN
Sbjct: 143 LTDPKWAGRICTRSGTNSYNIALTSAVIAHHGEEVALDWLKGVKAN 188


>gi|119387152|ref|YP_918207.1| extracellular solute-binding protein [Paracoccus denitrificans
           PD1222]
 gi|119377747|gb|ABL72511.1| extracellular solute-binding protein, family 1 [Paracoccus
           denitrificans PD1222]
          Length = 337

 Score = 40.4 bits (93), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ---GSPVDVIITKDETSL 85
           L LYT +  +++ P++ SF E TGVK++ I+        + Q    SP DV++T D  +L
Sbjct: 25  LNLYTTREPNLIEPLLASFTETTGVKVNTIFLKDGLPERVEQEGEASPADVLMTVDIGNL 84

Query: 86  ALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+ +     ++  +        L++++     +S   +VL Y+ K + +A    +
Sbjct: 85  V---DLVDRGLTQPVESEALSAAIPENLRDKDGNWFALSQRARVL-YAEKDLDLASF--T 138

Query: 140 VFDLTNAQWKKRLSI 154
             DL   +WK ++ I
Sbjct: 139 YEDLAKPEWKGKVCI 153


>gi|57237180|ref|YP_178192.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni RM1221]
 gi|57165984|gb|AAW34763.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni RM1221]
 gi|315057612|gb|ADT71941.1| Ferric iron ABC transporter, iron-binding protein [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 334

 Score = 40.4 bits (93), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 81/154 (52%), Gaps = 18/154 (11%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           +L+ L  F+   ++E     L +Y+ ++ +    II  FEE+TG+K++     +   I+R
Sbjct: 5   FLMFLTAFSFLGASE-----LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISF 119
             +    SP D+ I  D ++L  A N  LL  + +  +++  F+   L++++K+   I+ 
Sbjct: 60  LSLEGSNSPADIFIAADISNLTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITK 117

Query: 120 DTQVLAYS-TKRIKIADLPKSVFDLTNAQWKKRL 152
             +++AY+    I I+ + K+  DL  A++K  +
Sbjct: 118 RARIIAYNKNANIDISKM-KNYEDLAKAEFKGEI 150


>gi|88799343|ref|ZP_01114921.1| ABC-type Fe3+ transport system, periplasmic component [Reinekea sp.
           MED297]
 gi|88777882|gb|EAR09079.1| ABC-type Fe3+ transport system, periplasmic component [Reinekea sp.
           MED297]
          Length = 338

 Score = 40.4 bits (93), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 95/202 (47%), Gaps = 30/202 (14%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           FK+ +   +L   G T   + +     +++Y+ + ++++ P++  F E+TG+K++ +  S
Sbjct: 3   FKQWVGALVLTSVGLTATAAEQ-----VSVYSARKEALIKPLLDQFSEQTGIKVNLVTGS 57

Query: 62  S---IQRPPI-TQGSPVDVIITKDETSL----------ALNEDLLH-KLPAHLIKKNSFV 106
           +   ++R  +  Q S  DV +T D   L           +  D+L  ++PA+L   ++F 
Sbjct: 58  ADTLLKRLELEGQYSKADVFVTVDAGRLYRAKMAEVLQPIESDVLEARVPANLQDADNFW 117

Query: 107 LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLL 165
                     +S   + + Y+   +   ++ +S   L + QW+ R+ + + +NI    L+
Sbjct: 118 FG--------LSQRARTVFYNKNTVADGEI-QSYEQLADEQWRGRICVRSSDNIYNQSLV 168

Query: 166 NTMEQTPNKTVVQDFIKNITAN 187
            ++ +       +++ + + AN
Sbjct: 169 ASLIEHNGIDATENWAEGVVAN 190


>gi|157414489|ref|YP_001481745.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157385453|gb|ABV51768.1| iron transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|307747132|gb|ADN90402.1| Iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni M1]
          Length = 334

 Score = 40.4 bits (93), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           + + L  F+   ++E     L +Y+ ++      II  FEE+TG+K++     +   I+R
Sbjct: 5   FFMFLTAFSFLGASE-----LNIYSARHYDADFEIIKKFEEKTGIKVNHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISF 119
             +    SP D+ IT D ++L  A N  LL  + +  +++  F+   L++++K+   I+ 
Sbjct: 60  LSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITK 117

Query: 120 DTQVLAYS-TKRIKIADLPKSVFDLTNAQWKKRL 152
             +++AY+    I I+ + K+  DL  A++K  +
Sbjct: 118 RARIIAYNKNANIDISKM-KNYEDLAKAEFKGEI 150


>gi|28378429|ref|NP_785321.1| ABC transporter, substrate binding protein [Lactobacillus plantarum
           WCFS1]
 gi|28271265|emb|CAD64169.1| ABC transporter, substrate binding protein [Lactobacillus plantarum
           WCFS1]
          Length = 336

 Score = 40.0 bits (92), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 69/142 (48%), Gaps = 16/142 (11%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSP-VDVII 78
           + + + LT+Y    + +   IIH FE +TG+K+     ++   + +    QG+P  DV+I
Sbjct: 36  QTSQQVLTVYAAGPKPLSDQIIHGFEAKTGIKVKSFDGTTGKILSKVKAEQGNPQADVLI 95

Query: 79  TKDETS---LALNEDLLHKLPA---HLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
                +   L  N  LL   P+   HL K+     K+ + +L+  S     + Y+T+ IK
Sbjct: 96  LASMAAGVDLQKNGQLLTYQPSQAKHLNKQ----FKDTSHQLINYSASAVGITYNTRHIK 151

Query: 133 IADLPKSVFDLTNAQWKKRLSI 154
            A  P    DLT A ++ +++I
Sbjct: 152 SA--PTDWSDLTTAPYRNQVTI 171


>gi|225181033|ref|ZP_03734480.1| extracellular solute-binding protein family 1 [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168230|gb|EEG77034.1| extracellular solute-binding protein family 1 [Dethiobacter
           alkaliphilus AHT 1]
          Length = 348

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 63/149 (42%), Gaps = 3/149 (2%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            I T +LL           +  + L +Y+ +N+  +  ++  F E TG+++  ++ ++  
Sbjct: 6   VILTGILLAVSILAFSGCGSAEEQLVVYSGRNERFVQELLDKFTEETGIQVVALHGANAL 65

Query: 65  RPPITQGS-PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
           +    +G+   DV I+ D  +L     + LL       I       + +N     IS   
Sbjct: 66  QIVEERGNVQADVFISNDLGALGYLDQQGLLQGSEPEGIDTIPAGFRADNNAYFAISVRA 125

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKK 150
           +   Y+   I   ++PKS+ DL + +W  
Sbjct: 126 RGFIYNKDMITEEEMPKSIEDLFDPKWAG 154


>gi|70733249|ref|YP_263022.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347548|gb|AAY95154.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 333

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 82/174 (47%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSPVDVIITKD 81
           + +Y+ +   ++ P+  ++ ++TGVKI  I   + +  P+ Q        +  D+++T D
Sbjct: 26  VVVYSSRIDELIKPVFDAYTQKTGVKIKFI---TDKEAPLMQRIKAEGENATADLLLTVD 82

Query: 82  ETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
             +L   E +  L    + +I  N     ++ N     +S   + LAYST R+K ++L  
Sbjct: 83  AGNLWQAEQMGILQPFTSKVIDSNIPLQYRSSNHAWTGLSLRARTLAYSTDRVKPSEL-T 141

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
           +   L + QW+ RL +      +++     L+ T      + +++ ++ N++ +
Sbjct: 142 TYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAEKTEEIIKGWVNNLSTD 195


>gi|149180748|ref|ZP_01859251.1| ferric iron uptake ABC transporter (FeT) family, periplasmic
           substrate binding protein [Bacillus sp. SG-1]
 gi|148851538|gb|EDL65685.1| ferric iron uptake ABC transporter (FeT) family, periplasmic
           substrate binding protein [Bacillus sp. SG-1]
          Length = 386

 Score = 40.0 bits (92), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 90/215 (41%), Gaps = 48/215 (22%)

Query: 1   MFKRTIYTYLL---LLCGFTEAFSTENT--------------------TKYLTLYTDQNQ 37
           M K++++T LL   L  G   A S  NT                    +  + +YT ++ 
Sbjct: 22  MRKKSLWTTLLAFMLTFGVLAACSNNNTGNEAANNTGNTENNEQEVTDSGEVNVYTARHY 81

Query: 38  SVMLPIIHSFEERTGVKISPIYTSSIQ-------RPPITQGSPVDVIITKDETSL--ALN 88
                I   FEE TG+K++ I     +           T+G   DV IT D  +L  A  
Sbjct: 82  DTDDAIYKKFEEETGIKVNVIKGEGDELMERLKREGEATEG---DVFITADAGNLHKAKE 138

Query: 89  EDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQ 147
             LL  + +  +  N    L++ + + + ++   +V+ YS  R+  ++L  +  DLTN +
Sbjct: 139 AGLLQSIESETVNSNIDENLRDTDNQWVALTQRGRVIVYSKDRVDPSELS-TYEDLTNEK 197

Query: 148 WKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           W  ++           L+ + E   N++++  FI+
Sbjct: 198 WNGKV-----------LIRSSENIYNQSLMASFIE 221


>gi|320162372|ref|YP_004175597.1| ABC transporter substrate binding protein [Anaerolinea thermophila
           UNI-1]
 gi|319996226|dbj|BAJ64997.1| ABC transporter substrate binding protein [Anaerolinea thermophila
           UNI-1]
          Length = 378

 Score = 40.0 bits (92), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 84/184 (45%), Gaps = 22/184 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEE-RTGVKI-------SPIYTSSIQRPPITQGS 72
           + E     L +Y+ ++++++ P++ +F      V+I       S I  + I+     Q +
Sbjct: 63  AAETVGGKLVIYSGRSEALIQPVLDAFRALYPNVEIALKAGSNSEIANALIEE----QSN 118

Query: 73  P-VDVIITKD---ETSLALNEDLLHKLPAH--LIKKNSFVLKNENKKLMRISFDTQVLAY 126
           P  DV IT +      L+ N  L    PA   L+  +    +  +   + ++   +V+ Y
Sbjct: 119 PQADVFITTEVFTAQKLSENGVLAPYTPAQPDLLPADG---RAADGTWVALTRRARVILY 175

Query: 127 STKRIKIADLPKSVFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNIT 185
           +T  +   +LP S+FDLT+ +WK +++ A   N S    +  M     +   + ++K + 
Sbjct: 176 NTNLVPPEELPASIFDLTDPKWKGQVAAANSTNGSMQAQIAVMRHLYGEETTEAWLKGLM 235

Query: 186 ANEI 189
            NE+
Sbjct: 236 DNEV 239


>gi|152992551|ref|YP_001358272.1| iron (III) ABC transporter substrate-binding protein [Sulfurovum
          sp. NBC37-1]
 gi|151424412|dbj|BAF71915.1| iron (III) ABC transporter, substrate-binding protein [Sulfurovum
          sp. NBC37-1]
          Length = 334

 Score = 39.7 bits (91), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 34/55 (61%)

Query: 7  YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
          +  LL +     + S +N T+ +T+Y  ++Q    P++ +FE++TG+K++ +Y S
Sbjct: 4  FILLLFVSLIFTSCSKQNDTQSVTVYVSEDQVFSEPVLEAFEKKTGIKVNAVYDS 58


>gi|261491687|ref|ZP_05988268.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494450|ref|ZP_05990936.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309834|gb|EEY11051.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312640|gb|EEY13762.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P++ +FE+ TG+K++ I+        + Q    SP DV++T D + +
Sbjct: 26  VNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRV 85

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV-- 140
              +N DL  K+ + +++KN     ++ N +   ++   +V+  S  R  +  LP     
Sbjct: 86  MEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR--VGKLPAGFDY 143

Query: 141 FDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 144 LDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 191


>gi|3978164|gb|AAD03802.1| iron binding protein FbpA precursor [Mannheimia haemolytica]
 gi|110735169|gb|ABG89155.1| periplasmic iron binding protein A FbpA precursor [Mannheimia
           haemolytica]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P++ +FE+ TG+K++ I+        + Q    SP DV++T D + +
Sbjct: 26  VNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRV 85

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV-- 140
              +N DL  K+ + +++KN     ++ N +   ++   +V+  S  R  +  LP     
Sbjct: 86  MEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR--VGKLPAGFDY 143

Query: 141 FDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 144 LDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 191


>gi|332978331|gb|EGK15057.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Psychrobacter sp. 1501(2011)]
          Length = 374

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 86/173 (49%), Gaps = 19/173 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-------TQGSPVDVIITKD 81
           +T+Y+ +N+ ++ P++  F + TG+   P+   +    P+       +  +P DV++T D
Sbjct: 63  VTIYSSRNEQLIQPLLDEFTKETGI---PVELVTDDSGPLMARLEAESTNTPADVLLTVD 119

Query: 82  ETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
             +L  A  + LL  + + ++  N     ++ +     +S   + + Y   +++  DL  
Sbjct: 120 AGNLWQAGQQGLLQPIKSEVVNSNVPEKYRSVDDLWTGLSLRARTIFYDPAKVQPTDL-S 178

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHR-LLNTMEQ--TPNKT--VVQDFIKNITA 186
           +  DL + +WK +L +  +   +++ L+ +M +   P KT  +V+ ++ N+ A
Sbjct: 179 TYADLADPKWKGKLCLRTSKKVYNQSLVASMIEHYGPEKTEEIVKGWVANLAA 231


>gi|315931985|gb|EFV10938.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 328

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 78/147 (53%), Gaps = 14/147 (9%)

Query: 16  FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQG 71
           F  AFS    ++ L +Y+ ++      II  FEE+TG+K++     +   I+R  +    
Sbjct: 2   FLTAFSFLGASE-LNIYSARHYDADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSN 60

Query: 72  SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAY 126
           SP D+ IT D ++L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY
Sbjct: 61  SPADIFITADISNLTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAY 118

Query: 127 S-TKRIKIADLPKSVFDLTNAQWKKRL 152
           +    I I+ + K+  DL  A++K  +
Sbjct: 119 NKNANIDISKM-KNYEDLAKAEFKGEI 144


>gi|229593244|ref|YP_002875363.1| putative iron (III) ABC transporter substrate-binding protein
           [Pseudomonas fluorescens SBW25]
 gi|229365110|emb|CAY53330.1| putative iron (III) ABC transport system, substrate-binding protein
           [Pseudomonas fluorescens SBW25]
          Length = 334

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 81/174 (46%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSPVDVIITKD 81
           + +Y+ +   ++ P+  ++ ++TGV++  I   + +  P+ Q        +  D+++T D
Sbjct: 27  VVVYSSRIDELIKPVFDAYTQKTGVQVKFI---TDKEAPLMQRIKAEGENATADLLLTVD 83

Query: 82  ETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
             +L   E +  L    + +I KN     ++       +S   + +AYST R+K  DL  
Sbjct: 84  AGNLWQAEQMGILQPFTSAVIDKNIPLQYRSSKHAWTGLSLRARTIAYSTDRVKPGDL-T 142

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
           +   L + QW+ RL +      +++     L+ T      + +V+ ++ N++ +
Sbjct: 143 TYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAAKTEEIVKGWVNNLSTD 196


>gi|114561821|ref|YP_749334.1| extracellular solute-binding protein [Shewanella frigidimarina
           NCIMB 400]
 gi|114333114|gb|ABI70496.1| extracellular solute-binding protein, family 1 [Shewanella
           frigidimarina NCIMB 400]
          Length = 335

 Score = 39.7 bits (91), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           + L G     S+ +  + LT+Y+ +   ++ PI+  F E++GV ++ ++    I    + 
Sbjct: 7   VALLGLACVASSVSAAEALTVYSYRQAFLIEPILEKFTEQSGVDVNVVFAKDGIAERMVR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN 103
           +G  SP DV++T D + L   + +DL+  + + +I  N
Sbjct: 67  EGRLSPADVVLTSDFSRLMELVEKDLISPVDSAVIDSN 104


>gi|254360752|ref|ZP_04976900.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
 gi|153091322|gb|EDN73296.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
          Length = 318

 Score = 39.7 bits (91), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P++ +FE+ TG+K++ I+        + Q    SP DV++T D + +
Sbjct: 2   VNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRV 61

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV-- 140
              +N DL  K+ + +++KN     ++ N +   ++   +V+  S  R  +  LP     
Sbjct: 62  MEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR--VGKLPAGFDY 119

Query: 141 FDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 120 LDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 167


>gi|319949480|ref|ZP_08023536.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Dietzia
           cinnamea P4]
 gi|319436851|gb|EFV91915.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Dietzia
           cinnamea P4]
          Length = 327

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/160 (19%), Positives = 69/160 (43%), Gaps = 12/160 (7%)

Query: 14  CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG 71
           CG       ++    + +Y  Q++S+   +  +F   TG+++     S   +    + +G
Sbjct: 11  CGL------DSGDDAVIVYNAQHESLTRELADAFTRETGIEVELRNGSDFDLGNQLVAEG 64

Query: 72  --SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
             S  DV +T++  ++++   E LL  +    + +     +      + I+  + V  Y+
Sbjct: 65  DASRADVYLTENSPAISMVAREGLLAPVADETVGQVPPEYRPSTGDWVGIAARSTVFVYN 124

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNT 167
           T  +   +LP S  DL++ +W  R   AP    F  +++ 
Sbjct: 125 TTAVTEDELPTSFSDLSSPRWAGRWGAAPAGADFQAIVSA 164


>gi|39654597|pdb|1Q35|A Chain A, Crystal Structure Of Pasteurella Haemolytica Apo Ferric
           Ion- Binding Protein A
 gi|49259000|pdb|1SI0|A Chain A, Crystal Structure Of Mannheimia Haemolytica Ferric Iron-
           Binding Protein A In A Closed Conformation
 gi|49259001|pdb|1SI1|A Chain A, Crystal Structure Of Mannheimia Haemolytica Ferric Iron-
           Binding Protein A In An Open Conformation
          Length = 320

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P++ +FE+ TG+K++ I+        + Q    SP DV++T D + +
Sbjct: 4   VNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRV 63

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV-- 140
              +N DL  K+ + +++KN     ++ N +   ++   +V+  S  R  +  LP     
Sbjct: 64  MEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDR--VGKLPAGFDY 121

Query: 141 FDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 122 LDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 169


>gi|330952093|gb|EGH52353.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae Cit 7]
          Length = 333

 Score = 39.3 bits (90), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 10/142 (7%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDV 76
           ST      + +Y+ +   ++ P+  ++   TGVKI  I       +QR     Q +P D+
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGQNAPADL 77

Query: 77  IITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L   E +  L    + +I+ N     ++       +S   + +AYST R+K 
Sbjct: 78  LLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVKP 137

Query: 134 ADLPKSVFD-LTNAQWKKRLSI 154
           A+L  S ++ L +  W+ RL +
Sbjct: 138 AEL--STYEALADKNWEGRLCL 157


>gi|239816671|ref|YP_002945581.1| extracellular solute-binding protein family 1 [Variovorax paradoxus
           S110]
 gi|239803248|gb|ACS20315.1| extracellular solute-binding protein family 1 [Variovorax paradoxus
           S110]
          Length = 354

 Score = 39.3 bits (90), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 79/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           LTLYT +  +++ P+I +F  ++ +K++ ++     ++R       SP DV++T D  +L
Sbjct: 38  LTLYTTREAALIQPLISAFSAQSKIKVNTVFVKDGLLERVKAEGARSPADVLMTVDIGNL 97

Query: 86  ALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       +K  +        L+  + +   +S   +VL Y+ +     D P +
Sbjct: 98  M---DLVDGGVTQPVKSAALESAVPANLRGADGQWFALSLRARVL-YADR-----DQPIT 148

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL N +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 149 SFRYEDLANPKWKGKVCIRAGQHPYNTALIAAMIAHDGEAKTEQWLRGVKAN 200


>gi|58584655|ref|YP_198228.1| ABC-type Fe3+ transport system, periplasmic component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418971|gb|AAW70986.1| ABC-type Fe3+ transport system, periplasmic component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 343

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 81/175 (46%), Gaps = 18/175 (10%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQGSPVDVIITK 80
           N  + + +Y+ + + ++  +   F   TG+K+  I   Y+  + R  +  GS  DV +T 
Sbjct: 28  NDLQVVNVYSSRKEELVRTLFDEFTRNTGIKVRYIIDDYSQLLSR--MENGSGTDVFLTA 85

Query: 81  DETSLAL--NEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D  +L L     LL ++ + ++K+      ++       ++  T++L Y+ + +   DL 
Sbjct: 86  DAVNLILAKKRGLLSQVNSEILKRAIPEKFRDSEGYWFGLTKRTRILVYNKESVDPKDLS 145

Query: 138 KSVFDLTNAQWKKRL----SIAPNN---ISFHRLLNTMEQTPNKTVVQDFIKNIT 185
            +  DL N +WK ++    S +P N   I+F    N  E+T  K  V   + N+ 
Sbjct: 146 -TYEDLANKKWKGKILVRSSTSPYNRSLIAFMIANNGFEKT--KEWVSGIVSNMA 197


>gi|312963750|ref|ZP_07778221.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311281785|gb|EFQ60395.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 334

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 81/174 (46%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSPVDVIITKD 81
           + +Y+ +   ++ P+  ++ ++TGV++  I   + +  P+ Q        +  D+++T D
Sbjct: 27  VVVYSSRIDELIKPVFDAYTKKTGVQVKFI---TDKEAPLMQRIKAEGENATADLLLTVD 83

Query: 82  ETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
             +L   E +  L    + +I KN     ++       +S   + +AYST R+K  DL  
Sbjct: 84  AGNLWQAEQMGILQPFTSAVIDKNIPLQYRSSAHAWTGLSLRARTIAYSTDRVKPGDL-T 142

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
           +   L + QW+ RL +      +++     L+ T      + +V+ ++ N++ +
Sbjct: 143 TYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAAKTEAIVKGWVNNLSTD 196


>gi|78065789|ref|YP_368558.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
 gi|77966534|gb|ABB07914.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           sp. 383]
          Length = 347

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDVGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K     I  N   L+  N     +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLTQPVRSKALDDAIPAN---LRGANGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|256829621|ref|YP_003158349.1| family 1 extracellular solute-binding protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256578797|gb|ACU89933.1| extracellular solute-binding protein family 1 [Desulfomicrobium
           baculatum DSM 4028]
          Length = 332

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 38/213 (17%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTE------NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI 55
            KR +    +LLC    A + E            T Y   N + + PI+ +FE  TGVK 
Sbjct: 1   MKRLVVVIAILLCSALSAQAAELDPAKAKAEGTATFYA--NITAVEPIMEAFEADTGVKG 58

Query: 56  SPIYTSSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVL-------- 107
           +  YT       I+    +  ++T+ E    + + +   LP   I K+  VL        
Sbjct: 59  A--YTR------ISTSKFLATVLTEFEAGKLMADVVQAPLPVLEILKSKGVLASYSSPAA 110

Query: 108 --------KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA--PN 157
                   K++  +L  I +    L Y+ + +K AD+PK   DL + +WK ++ +A   N
Sbjct: 111 AGYADWTRKDDAIQLFGIEYVG--LIYNKELVKAADVPKRYEDLADPKWKDKIVMANPAN 168

Query: 158 NISFHRLLNTMEQT--PNKTVVQDFIKNITANE 188
           + +    L  +++T   ++     F+K + AN+
Sbjct: 169 HATTISWLVGLKETVFTSEEEWMSFLKGLAANK 201


>gi|293605619|ref|ZP_06687999.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Achromobacter piechaudii ATCC 43553]
 gi|292815999|gb|EFF75100.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Achromobacter piechaudii ATCC 43553]
          Length = 347

 Score = 39.3 bits (90), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVII 78
           T N  + ++LYT +   ++ P++ +F + +G+K++ ++     ++R       SP DV++
Sbjct: 25  TANAAEEVSLYTTREPKLIQPLLDAFTKESGIKVNTVFVKDGLLERVKAEGAKSPADVLM 84

Query: 79  TKDETSLALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIK 132
           T D  +L    DL+       +K  +        L+  + K   +S   +VL Y  K +K
Sbjct: 85  TVDIGNLL---DLVDGGVTQSVKSETLESVIPANLRGADGKWYALSLRDRVL-YVEKDLK 140

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
           +        DL + +WK ++ I      ++  ++ +M         + +++ + AN
Sbjct: 141 LESF--RYEDLADPKWKGKVCIRSGQHPYNTAMVASMIAHDGAEATEKWLRGVKAN 194


>gi|148652678|ref|YP_001279771.1| extracellular solute-binding protein [Psychrobacter sp. PRwf-1]
 gi|148571762|gb|ABQ93821.1| extracellular solute-binding protein, family 1 [Psychrobacter sp.
           PRwf-1]
          Length = 372

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 79/171 (46%), Gaps = 25/171 (14%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-------TQGSPVDVII 78
            K +T+Y+ +N+ ++ P++  F + TG+   P+   +    P+       +  +P D+++
Sbjct: 58  AKTVTIYSSRNEQLIQPLLDEFTKETGI---PVELVTDDSGPLMARLQAESTNTPADMLL 114

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLM-RISFDTQVLAYSTKRIKIAD 135
           T D  +L  A  + LL  L + ++  N     +    L   +S   + + Y   ++  +D
Sbjct: 115 TVDAGNLWQAAQQGLLQPLNSEVVNSNVPAKYHSVDDLWTGLSLRARTIFYDPAKVNPSD 174

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           L  +  DL + +WK +L            L T ++  N+++V   I+++ A
Sbjct: 175 L-STYADLADPKWKGKL-----------CLRTSKKVYNQSLVASMIEHLGA 213


>gi|167587575|ref|ZP_02379963.1| ABC transporter, periplasmic ligand binding protein [Burkholderia
           ubonensis Bu]
          Length = 347

 Score = 38.9 bits (89), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++G+K++ ++     ++R     G SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGIKVNTVFVKDGLLERVKAEGGQSPADVLMTVDVGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K     I  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLTQPVRSKALDDAIPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|86151205|ref|ZP_01069420.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|205356575|ref|ZP_03223338.1| putative iron uptake ABC transport system periplasmic iron binding
           protein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|85841552|gb|EAQ58799.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|205345580|gb|EDZ32220.1| putative iron uptake ABC transport system periplasmic iron binding
           protein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 334

 Score = 38.9 bits (89), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 20  LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 79

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYS-TKRIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 80  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNANIDISKM-K 136

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 137 NYEDLAKAEFKGEI 150


>gi|163739372|ref|ZP_02146783.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis BS107]
 gi|163743633|ref|ZP_02151009.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161383104|gb|EDQ07497.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161387442|gb|EDQ11800.1| iron uptake protein A1 [Phaeobacter gallaeciensis BS107]
          Length = 338

 Score = 38.9 bits (89), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVIITKDETS 84
           L LY+ ++      +   FEE TG+ I+ I   +   I R       SP D+++T D + 
Sbjct: 26  LNLYSSRHYDTDERLYSDFEEATGITINRIEGKADELIARMSAEGANSPADILLTVDTSR 85

Query: 85  LAL--NEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           LA   NE LL  + +  ++      L++ + +    S   +++ +   +  +A  PK+  
Sbjct: 86  LARAKNEGLLQAIDSDTLEARVPGYLQDADNQWFGFSQRARIIFFD--KADVATPPKTYL 143

Query: 142 DLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIKNITAN 187
           DL +  +K ++ I  +  ++++ LL ++     +    D+ K + AN
Sbjct: 144 DLADPAYKGQVCIRSSTNTYNQTLLASIVTHHGEEAATDWAKGVVAN 190


>gi|283955621|ref|ZP_06373114.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792846|gb|EFC31622.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni 1336]
          Length = 334

 Score = 38.9 bits (89), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 72/134 (53%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++      II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 20  LNIYSARHYDADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGNNSPADIFITADISN 79

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYS-TKRIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 80  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNANIDISKM-K 136

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 137 NYEDLAKAEFKGEI 150


>gi|172037545|ref|YP_001804046.1| iron transport protein [Cyanothece sp. ATCC 51142]
 gi|171698999|gb|ACB51980.1| iron transport protein [Cyanothece sp. ATCC 51142]
          Length = 383

 Score = 38.9 bits (89), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 84/179 (46%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGS 72
           T + S   TT  + LY+ ++ +    +   F + TG+K++ +  S+   I+R     + +
Sbjct: 58  TSSPSATETTGEVNLYSSRHYNTDTELYEGFTQETGIKVNLVEGSADELIERINSEGENT 117

Query: 73  PVDVIITKDETSLALNEDLLHKLP---AHLIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
             D+++T D   L   E+     P   A L ++    L+N        +   +V+ Y+  
Sbjct: 118 QADILMTVDVARLWRAEEAGIFAPTTSAILEERVPASLRNPEGLWFGFTKRARVIMYNQD 177

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++   +L  +  DL + +WK R+ I P +NI    L+ ++ +T  +   ++++K   AN
Sbjct: 178 KVNPEEL-STYEDLADPKWKGRIIIRPSSNIYNQSLVASLIETHGEEQTEEWVKGFVAN 235


>gi|86153893|ref|ZP_01072096.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88597262|ref|ZP_01100497.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|148926341|ref|ZP_01810025.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|218561854|ref|YP_002343633.1| putative iron-uptake ABC transporter,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|85842854|gb|EAQ60066.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88190323|gb|EAQ94297.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359560|emb|CAL34344.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|145844733|gb|EDK21838.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|284925467|gb|ADC27819.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315929092|gb|EFV08323.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni 305]
          Length = 334

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 20  LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 79

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTK-RIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 80  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKM-K 136

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 137 NYEDLAKAEFKGEI 150


>gi|104784216|ref|YP_610714.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           entomophila L48]
 gi|95113203|emb|CAK17931.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas entomophila L48]
          Length = 333

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGENGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I KN     +  +     +S   + +AYST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIKSDIIDKNIPAQYRASSHDWTGLSLRARTIAYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K ++L  S ++ L +  W+ RL +      +++     L+    +   + +V+D++ N+
Sbjct: 135 VKPSEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIENHGEAATEKLVKDWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|86149659|ref|ZP_01067889.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839927|gb|EAQ57186.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 334

 Score = 38.9 bits (89), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 20  LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 79

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTK-RIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 80  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKM-K 136

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 137 NYEDLAKAEFKGEI 150


>gi|315927786|gb|EFV07112.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 328

 Score = 38.9 bits (89), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 14  LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 73

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTK-RIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 74  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKM-K 130

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 131 NYEDLAKAEFKGEI 144


>gi|71066102|ref|YP_264829.1| ABC iron transporter, periplasmic binding protein [Psychrobacter
           arcticus 273-4]
 gi|71039087|gb|AAZ19395.1| ABC iron transporter, periplasmic binding protein [Psychrobacter
           arcticus 273-4]
          Length = 374

 Score = 38.5 bits (88), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/184 (18%), Positives = 88/184 (47%), Gaps = 21/184 (11%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-------TQG 71
           A S +  T  +T+Y+ +N+ ++ P++  + E+TGVK+  +   + +  P+        + 
Sbjct: 59  AASADGQT--VTIYSSRNEQLIKPLLDRYTEQTGVKVELV---TDKDGPLMARLQAEGKN 113

Query: 72  SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLM-RISFDTQVLAYST 128
           +P D+++T D  +L  A  + LL  + + +++ N      +   L   +S   + + Y  
Sbjct: 114 TPADILLTVDAGNLWQATEQGLLQPVASSVLEANVPAKYRDPAGLWTGLSLRARTIFYDP 173

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKN 183
            ++  AD   +  DL + +WK +L +  +   +++     ++  +     + V++ ++ N
Sbjct: 174 SKVS-ADQLSTYADLADPKWKGKLCLRTSKKVYNQSLVASMMEHLGAEKTEAVIRGWVDN 232

Query: 184 ITAN 187
           +  +
Sbjct: 233 LATD 236


>gi|311106520|ref|YP_003979373.1| extracellular solute-binding family protein [Achromobacter
           xylosoxidans A8]
 gi|310761209|gb|ADP16658.1| bacterial extracellular solute-binding family protein 8
           [Achromobacter xylosoxidans A8]
          Length = 347

 Score = 38.5 bits (88), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVII 78
           + N  + ++LYT +   ++ P++ +F + +G+K++ ++     ++R       SP DV++
Sbjct: 25  SANAAEEVSLYTTREPKLIQPLLDAFTKESGIKVNTVFVKDGLLERVKAEGAKSPADVLM 84

Query: 79  TKDETSLALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIK 132
           T D  +L    DL+       IK  +        L+  + K   +S   +VL Y  K +K
Sbjct: 85  TVDIGNLL---DLVDGGVTQSIKSQTLESVIPPNLRGADGKWYALSLRDRVL-YVEKDLK 140

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
           +        DL + +WK ++ I      ++  L+ +M         + +++ + AN
Sbjct: 141 LEAF--RYEDLADPKWKGKVCIRSGQHPYNTALVASMIAHDGAEATEKWLRGVKAN 194


>gi|226951477|ref|ZP_03821941.1| extracellular solute-binding protein [Acinetobacter sp. ATCC 27244]
 gi|294651000|ref|ZP_06728340.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Acinetobacter haemolyticus ATCC 19194]
 gi|226837770|gb|EEH70153.1| extracellular solute-binding protein [Acinetobacter sp. ATCC 27244]
 gi|292823101|gb|EFF81964.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Acinetobacter haemolyticus ATCC 19194]
          Length = 338

 Score = 38.5 bits (88), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 83/187 (44%), Gaps = 15/187 (8%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPI 68
           + L G     S+      + LYT +   ++ P++  F E+TGVK++ ++     ++R   
Sbjct: 9   IALAGLVALGSSWANAAQVNLYTTREPVLIQPLLQEFSEKTGVKVNTVFIKDGLLERVKA 68

Query: 69  -TQGSPVDVIITKDETSL------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
             + SP DV++T D  +L       L + +  K+    I  N   L+  N     +S   
Sbjct: 69  EGRRSPADVMLTVDFGNLVDLVEGGLTQRINSKVLNTAIPGN---LRAANGHWYALSMRA 125

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDF 180
           + +  S +R  +  +  +  DL + +WK ++ I   + +++  L+        +   + +
Sbjct: 126 RAVYASKERTPLTAI--NYEDLADPKWKGKICIRSGSHAYNTSLIAAYITHHGEKATEQW 183

Query: 181 IKNITAN 187
           ++ + AN
Sbjct: 184 LRGVKAN 190


>gi|60594117|pdb|1Y4T|A Chain A, Ferric Binding Protein From Campylobacter Jejuni
 gi|60594118|pdb|1Y4T|D Chain D, Ferric Binding Protein From Campylobacter Jejuni
 gi|255917854|pdb|3E13|X Chain X, Iron Reconstituted Ferric Binding Protein From
           Campylobacter Jejuni
          Length = 322

 Score = 38.5 bits (88), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 4   LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 63

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTK-RIKIADLPK 138
           L  A N  LL  + +  +++  F+   L++++K+   I+   +++AY+    I I+ + K
Sbjct: 64  LTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEWFAITKRARIIAYNKNTNIDISKM-K 120

Query: 139 SVFDLTNAQWKKRL 152
           +  DL  A++K  +
Sbjct: 121 NYEDLAKAEFKGEI 134


>gi|57168653|ref|ZP_00367785.1| iron transport protein [Campylobacter coli RM2228]
 gi|305432718|ref|ZP_07401878.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter
           [Campylobacter coli JV20]
 gi|57019934|gb|EAL56614.1| iron transport protein [Campylobacter coli RM2228]
 gi|304444227|gb|EFM36880.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter
           [Campylobacter coli JV20]
          Length = 334

 Score = 38.5 bits (88), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 20/111 (18%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           + L L GF+   + E     L +Y+ ++      II  FEE+TG+K++     +   I+R
Sbjct: 5   FSLCLLGFSLLGAAE-----LNIYSARHYDADFQIIKKFEEKTGIKVNHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSL--ALNEDLL---------HKLPAHLIKKNS 104
             +    SP D+ IT D ++L  A N  LL           +PAHL  K+ 
Sbjct: 60  LSLEGSNSPADIFITADISNLTEAKNSGLLSPVKSKYLEDTIPAHLRDKDG 110


>gi|212712681|ref|ZP_03320809.1| hypothetical protein PROVALCAL_03778 [Providencia alcalifaciens DSM
           30120]
 gi|212684597|gb|EEB44125.1| hypothetical protein PROVALCAL_03778 [Providencia alcalifaciens DSM
           30120]
          Length = 386

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 93/196 (47%), Gaps = 27/196 (13%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-- 62
           T+ + L++ C    A + ++    LTLYT +   ++ P++ +F + T + ++ +Y     
Sbjct: 54  TLASSLIVTCALP-AMAKDS----LTLYTTREPGLIQPLLDAFTKETAIDVNTVYVKDGM 108

Query: 63  IQRPPI-TQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFV------LKNENKKLM 115
           ++R     + SP D+++T D  +L    DL+       ++  +        L++++ +  
Sbjct: 109 LERVKAEGKNSPADLLMTVDAGNLI---DLVEAGVTQPVESKTLTDAIPASLRDKDNQWF 165

Query: 116 RISFDTQVLAYSTKRIKIADLP-KSVF--DLTNAQWKKRLSIAPNNISFH-RLLNTMEQT 171
            +S   +VL Y+ K     DLP KS+   DL + +WK ++ I      ++  L+  M   
Sbjct: 166 GLSMRARVL-YAEK-----DLPLKSITYEDLADPKWKDKICIRAGQHPYNTALVAAMIAH 219

Query: 172 PNKTVVQDFIKNITAN 187
             +   + +++ + AN
Sbjct: 220 DGEAKTEAWLRGVKAN 235


>gi|170732533|ref|YP_001764480.1| extracellular solute-binding protein [Burkholderia cenocepacia
           MC0-3]
 gi|254245835|ref|ZP_04939156.1| Extracellular solute-binding protein, family 1 [Burkholderia
           cenocepacia PC184]
 gi|124870611|gb|EAY62327.1| Extracellular solute-binding protein, family 1 [Burkholderia
           cenocepacia PC184]
 gi|169815775|gb|ACA90358.1| extracellular solute-binding protein family 1 [Burkholderia
           cenocepacia MC0-3]
          Length = 347

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITK 80
           +  + ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T 
Sbjct: 27  HAAEEVSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTV 86

Query: 81  DETSL------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           D  +L       L + +  K+    I  N   L+  N     +S   +VL Y  K +K+ 
Sbjct: 87  DVGNLLDLVDGGLTQPVRSKVLDDAIPAN---LRATNGDWYALSLRDRVL-YVEKDLKV- 141

Query: 135 DLPKSVF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
                 F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 142 ----DAFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|229917657|ref|YP_002886303.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
 gi|229469086|gb|ACQ70858.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
          Length = 353

 Score = 38.1 bits (87), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 80/165 (48%), Gaps = 23/165 (13%)

Query: 8   TYLLLLCGFT-EAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-- 62
           T LL  C  T E  S E +  +  + +Y+ ++  V   +   FEE TG+K++ +   S  
Sbjct: 16  TSLLAACASTDETTSNEGSDDSNVVNVYSSRHYDVDQQLYKQFEEETGIKVNVVEGKSDE 75

Query: 63  -IQRPPITQG--SPVDVIITKDETSLALNEDLLH-------KLPAHLIKKNSFVLKNENK 112
            ++R   T+G  +  D+ IT D  +L   ++  H       +L +++ +K     ++ + 
Sbjct: 76  LLERLN-TEGENTEADLFITADAGNLYQAKEAGHLQAVDSDELESNIPEK----YRDTDN 130

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFD-LTNAQWKKRLSIAP 156
           +   ++   +V+ YS  R+K  DL  S ++ LT  QW  ++ + P
Sbjct: 131 EWFGLTKRARVIVYSKDRVKPEDL--STYEALTEEQWNGKVLVRP 173


>gi|332524214|ref|ZP_08400440.1| ABC transporter iron binding protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332107549|gb|EGJ08773.1| ABC transporter iron binding protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 341

 Score = 38.1 bits (87), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 72/149 (48%), Gaps = 12/149 (8%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQG--SPVDVIITKDETS 84
           +T+Y+ + + ++ P +  + + TGV+I+ +     S+      +G  SP DV+IT D  +
Sbjct: 30  VTVYSSRIEQLLKPTLDRYTQETGVRINLLTDRGGSLTERLAAEGASSPADVLITVDMGN 89

Query: 85  L--ALNEDLLHKLPAHLIKKN---SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           L  A    LL KL +  +  N   SF  ++   +   +S   + + Y+  +++ A L  +
Sbjct: 90  LWNAAERGLLRKLQSPTLDANVPASF--RDPGSRWWGLSQRERTIFYAAGKVQPAQL-ST 146

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTM 168
             DL   +WK +L +     ++ + L  M
Sbjct: 147 YEDLALPKWKGKLCLRTGKQTYTQSLVAM 175


>gi|14521007|ref|NP_126482.1| thiamine-binding periplasmic protein precursor [Pyrococcus abyssi
           GE5]
 gi|5458224|emb|CAB49713.1| Thiamine-binding periplasmic protein precursor [Pyrococcus abyssi
           GE5]
          Length = 352

 Score = 38.1 bits (87), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 75/156 (48%), Gaps = 12/156 (7%)

Query: 10  LLLLC--GFTEAFSTENTTKYLTLYT-DQNQSVMLPIIHSFEERTGVKISPIYTSS---- 62
           L L C  G TE   T+   K LT+Y  D  +  +  +I  FE+    K++ +   S    
Sbjct: 16  LALGCIGGKTET-ETKVENKELTVYAYDSLEYWLKEVIPEFEKEYNAKVNLVLVGSTGEL 74

Query: 63  IQRPPITQGSP-VDVIITKDETSLA--LNEDLLHKL-PAHLIKKNSFVLKNENKKLMRIS 118
           + R  + + +P  DV++  D T LA  +  D+L    P +      +++K+ + +     
Sbjct: 75  VNRLILEKDNPKADVVVGIDNTFLAKAIEADVLEPYKPKNADVIPEWIIKSFDPEFRLTP 134

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
           FD   LA++ +   + + PKS+ DLT  +W+ ++ I
Sbjct: 135 FDYGFLAFNYRTDLVKEPPKSLEDLTKPEWRGKIII 170


>gi|148244799|ref|YP_001219493.1| iron ABC transporter substrate-binding protein [Candidatus
           Vesicomyosocius okutanii HA]
 gi|146326626|dbj|BAF61769.1| iron ABC transporter substrate-binding protein [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 339

 Score = 38.1 bits (87), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 73/152 (48%), Gaps = 8/152 (5%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRP 66
           +LLL   +   +   +   +T+Y+ + + ++ P+  SF   TG++++ +       I+R 
Sbjct: 13  VLLLVVTSVGIARARSEDLVTVYSSRKEHLIKPLFESFTRDTGIQVTYLTGKGGALIERL 72

Query: 67  PI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLM-RISFDTQ 122
            +  + +  D+ +T D  +L  A  +DL   +    ++ N      ++K L   +S   +
Sbjct: 73  KLEGKNTNADMFMTVDAGNLWYAATQDLFQAVQTQTLENNIPSHLRDSKGLWTGLSVRAR 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
            + YST+R+   DL  +  +L + +W  RL +
Sbjct: 133 TIVYSTERVNPVDLS-TYENLADTKWAGRLCL 163


>gi|320530671|ref|ZP_08031717.1| bacterial extracellular solute-binding protein [Selenomonas
           artemidis F0399]
 gi|320137079|gb|EFW29015.1| bacterial extracellular solute-binding protein [Selenomonas
           artemidis F0399]
          Length = 319

 Score = 38.1 bits (87), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 11/149 (7%)

Query: 14  CGFT-EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPIT 69
           CG + + F T++ T  + +Y    +    PI   F+E TG+++  +   S   + R    
Sbjct: 8   CGSSKQQFETDDNT--VVVYNCNTEDWTAPIAKEFQEETGIRVKLVAGGSGELMARVRTE 65

Query: 70  QGSP-VDVIITKDETS-LALNEDLL-HKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAY 126
           +  P  DV+    E + +AL   L  +  P        FV    N     ++ D  VLAY
Sbjct: 66  KEDPRGDVLWGGAEDAYVALTPYLEPYDSPEKTAIDPHFV--RANNVFYSVTMDPFVLAY 123

Query: 127 STKRIKIADLPKSVFDLTNAQWKKRLSIA 155
           +T  +  AD P+   DL + +++ R+++A
Sbjct: 124 NTDLVSEADAPQGWRDLLDPKFRGRIALA 152


>gi|283955388|ref|ZP_06372887.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283793148|gb|EFC31918.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 334

 Score = 38.1 bits (87), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 79/159 (49%), Gaps = 20/159 (12%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           + I++  L+   F  A         L +Y+ ++      II  FEE+TG+KI+     + 
Sbjct: 2   KKIFSIFLMAFSFLGAAE-------LNIYSARHYDADFEIIKKFEEKTGIKINHTQAKAS 54

Query: 63  --IQRPPI-TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKL 114
             I+R  +    SP DV IT D ++L  A N  LL  + +  +++  F+   L++++K+ 
Sbjct: 55  ELIKRLSLEGSNSPADVFITADISNLTEAKNLGLLSPVSSKYLEE--FIPAHLRDKDKEW 112

Query: 115 MRISFDTQVLAYS-TKRIKIADLPKSVFDLTNAQWKKRL 152
             I+   +++AY+    I I+ + K+  DL   ++K  +
Sbjct: 113 FAITKRARIIAYNKNANIDISKM-KNYEDLAKPEFKGEI 150


>gi|300767371|ref|ZP_07077283.1| ABC superfamily ATP binding cassette transporter, substrate binding
           protein [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|300495190|gb|EFK30346.1| ABC superfamily ATP binding cassette transporter, substrate binding
           protein [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
          Length = 336

 Score = 38.1 bits (87), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSP-VDVII 78
           + + + LT+Y    + +   IIH FE +TG+K+     ++   + +    QG+P  DV+I
Sbjct: 36  QTSQQVLTVYAAGPKPLSDQIIHGFEAKTGIKVKSFDGTTGKILSKVKAEQGNPQADVLI 95

Query: 79  TKDETS---LALNEDLLHKLPA---HLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
                +   L  N  LL   P+   HL K+     K+ + +L+  S     + Y+T+ IK
Sbjct: 96  LASMAAGVDLQKNGQLLTYQPSQAKHLNKQ----FKDTSHQLINYSASAVGITYNTRHIK 151

Query: 133 IADLPKSVFDLTNAQWKKRLSI 154
            A  P    DLT   ++ +++I
Sbjct: 152 SA--PTDWSDLTTTPYRNQVTI 171


>gi|308180583|ref|YP_003924711.1| ABC superfamily ATP binding cassette transporter, substrate binding
           protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|308046074|gb|ADN98617.1| ABC superfamily ATP binding cassette transporter, substrate binding
           protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 336

 Score = 37.7 bits (86), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSP-VDVII 78
           + + + LT+Y    + +   IIH FE +TG+K+     ++   + +    QG+P  DV+I
Sbjct: 36  QTSQQVLTVYVAGPKPLSDQIIHGFEAKTGIKVKSFDGTTGKILSKVKAEQGNPQADVLI 95

Query: 79  TKDETS---LALNEDLLHKLPA---HLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
                +   L  N  LL   P+   HL K+     K+ + +L+  S     + Y+T+ IK
Sbjct: 96  LASMAAGVDLQKNGQLLTYQPSQAKHLNKQ----FKDTSHQLINYSASAVGITYNTRHIK 151

Query: 133 IADLPKSVFDLTNAQWKKRLSI 154
            A  P    DLT   ++ +++I
Sbjct: 152 SA--PTDWSDLTTTPYRNQVTI 171


>gi|163750123|ref|ZP_02157366.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella benthica KT99]
 gi|161330180|gb|EDQ01162.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella benthica KT99]
          Length = 329

 Score = 37.7 bits (86), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 56/99 (56%), Gaps = 9/99 (9%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPI 68
           L L+C  + A + EN    LT+Y+ +   ++ PI+ +F + TG+ +  +++   I    +
Sbjct: 4   LGLVCFASAANAAEN----LTVYSYRQAFLVRPILANFTKETGIDVDVVFSKKGIAERMM 59

Query: 69  TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN 103
            +G  SP D+++T D + L   ++++L+  + + L+K N
Sbjct: 60  REGRLSPADIVLTSDFSRLMELVDKNLVIPVDSELLKAN 98


>gi|127511795|ref|YP_001092992.1| extracellular solute-binding protein [Shewanella loihica PV-4]
 gi|126637090|gb|ABO22733.1| extracellular solute-binding protein, family 1 [Shewanella
          loihica PV-4]
          Length = 335

 Score = 37.7 bits (86), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 11 LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
          L + GF    S  N    +T+Y+ +   ++ PI+  F + TG+K++ ++T   I      
Sbjct: 7  LAVLGFACVTSMANAADSITVYSYRQAFLIDPILADFTKETGIKVNLVFTKQGIAERIAR 66

Query: 70 QG--SPVDVIITKDETSL 85
          +G  SP D+++T D + L
Sbjct: 67 EGRLSPADLVLTSDFSRL 84


>gi|254556638|ref|YP_003063055.1| ABC transporter, substrate binding protein [Lactobacillus plantarum
           JDM1]
 gi|254045565|gb|ACT62358.1| ABC transporter, substrate binding protein [Lactobacillus plantarum
           JDM1]
          Length = 336

 Score = 37.7 bits (86), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSP-VDVII 78
           + + + LT+Y    + +   IIH FE +TG+K+     ++   + +    QG+P  DV+I
Sbjct: 36  QTSQQVLTVYAAGPKPLSDQIIHGFEAKTGIKVKSFDGTTGKILSKVKAEQGNPQADVLI 95

Query: 79  TKDETS---LALNEDLLHKLPA---HLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
                +   L  N  LL   P+   HL K+     K+ + +L+  S     + Y+T+ IK
Sbjct: 96  LASMAAGVDLQKNGQLLTYQPSQAKHLNKQ----FKDTSHQLINYSASAVGITYNTQHIK 151

Query: 133 IADLPKSVFDLTNAQWKKRLSI 154
            A  P    DLT   ++ +++I
Sbjct: 152 SA--PTDWSDLTTTPYRNQVTI 171


>gi|262370748|ref|ZP_06064073.1| extracellular solute-binding protein family 1 [Acinetobacter
           johnsonii SH046]
 gi|262314548|gb|EEY95590.1| extracellular solute-binding protein family 1 [Acinetobacter
           johnsonii SH046]
          Length = 338

 Score = 37.7 bits (86), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 74/153 (48%), Gaps = 14/153 (9%)

Query: 11  LLLCGFTEAFSTENT-TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPP 67
           LLL G   AFS        + LYT +   ++ P++  F ++TGVK++ ++     ++R  
Sbjct: 9   LLLTGLV-AFSCNWVHAAEVNLYTTREPVLIQPLLKEFSQKTGVKVNTVFIKDGLLERVK 67

Query: 68  I-TQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDT 121
              + SP DV++T D  +L   +   L  ++ + ++  NS +   L+  N     +S   
Sbjct: 68  AEGRRSPADVMLTVDFGNLVDLVESGLTQRVDSKVL--NSSIPGNLRAANGHWYALSMRA 125

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
           + +  S +R  I  +  S  DL + +WK ++ I
Sbjct: 126 RAVYVSKERTPITAI--SYEDLASPKWKDKICI 156


>gi|227535298|ref|ZP_03965347.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227187032|gb|EEI67099.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 352

 Score = 37.7 bits (86), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 14/157 (8%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSPV-DVI 77
           T   T  L +Y+  ++ ++   I +FEE+ GVK+  I   +    ++    +G+PV DVI
Sbjct: 38  TAKKTDKLVVYSPNSEGLINATIPAFEEKYGVKVDLIQAGTGELFKKLESEKGAPVADVI 97

Query: 78  ITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS---TKRIKIA 134
                T  A + DL  K  A    K     +N        + D  V+  +   TK + I 
Sbjct: 98  FGGSYTQYATSGDLFQKYTAKDNNKVEKAYRNTTGYSTPYTLDGSVIVVNPTLTKGMNI- 156

Query: 135 DLPKSVFDLTNAQWKKRLSIA-PNNIS--FHRLLNTM 168
              K   DL N   K +++ A P N S  F +L N +
Sbjct: 157 ---KGYGDLLNKDLKGKIATADPANSSSAFAQLTNML 190


>gi|77461651|ref|YP_351158.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77385654|gb|ABA77167.1| putative iron (III) ABC transport system, substrate-binding protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 334

 Score = 37.7 bits (86), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 73/162 (45%), Gaps = 18/162 (11%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           KR +    L L G T A + +     + +Y+ +   ++ P+  ++  +TGVKI  I   +
Sbjct: 5   KRVLTALALTLIGSTAAQAADE----VVVYSSRIDELIKPVFDAYTAKTGVKIKFI---T 57

Query: 63  IQRPPITQ-------GSPVDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENK 112
            +  P+ Q        +  D+++T D  +L   E +  L    +  I  N     ++ + 
Sbjct: 58  DKEAPLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSKTIDANIPLQYRSSSH 117

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
               +S   + +AYST+R+K  +L  +   L +  W+ RL +
Sbjct: 118 AWTGLSLRARTIAYSTERVKPGEL-TTYEALADKNWEGRLCL 158


>gi|262373022|ref|ZP_06066301.1| ABC-type Fe3+ transport system periplasmic component [Acinetobacter
           junii SH205]
 gi|262313047|gb|EEY94132.1| ABC-type Fe3+ transport system periplasmic component [Acinetobacter
           junii SH205]
          Length = 338

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 78/169 (46%), Gaps = 15/169 (8%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-TQG--SPVDVIITKDETSL 85
           + LYT +   ++ P++  F ++TG+K++ ++        + T+G  SP DV++T D  +L
Sbjct: 27  VNLYTTREPVLIQPLLEEFNQKTGIKVNTVFIKDGMLERVKTEGRRSPADVMLTVDFGNL 86

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L+  N     +S   + +  S +R  +  +  S
Sbjct: 87  VDLVENGLTQRVNSKVLNTAIPGN---LRAANGHWYALSMRARAVYVSKERTPLKAI--S 141

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL N +WK ++ I   +  ++  L+ +      +   + +++ I AN
Sbjct: 142 YEDLANPKWKGKICIRSGSHPYNTWLIASYIAHHGEKATEQWLRGIKAN 190


>gi|254422073|ref|ZP_05035791.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
 gi|196189562|gb|EDX84526.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
          Length = 346

 Score = 37.4 bits (85), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 89/189 (47%), Gaps = 14/189 (7%)

Query: 10  LLLLCGFTEA-FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           LL+  G T    S++   + + LY+ ++  V   +   F E+TG++++ +       I+R
Sbjct: 13  LLVGLGITACQGSSDQAEQVVNLYSARHYDVDEELYEEFTEQTGIQVNVLEGKPDELIER 72

Query: 66  -PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISF 119
                + SP DV I  D   L  A    +L  + + ++  NS V   L+  +     ++ 
Sbjct: 73  ISNEGEESPADVFIAVDAGRLWRAQEAGILQPVSSEVL--NSVVPENLREPSGLWYGLTT 130

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             ++L Y+T  ++  +L  +  DL + +W++R+ I +  N+    LL +M ++      +
Sbjct: 131 RARMLVYNTDNVQPEEL-STYEDLADPKWEERVCIRSSENVYNQSLLGSMVESIGPEATE 189

Query: 179 DFIKNITAN 187
            + + + +N
Sbjct: 190 TWAEGLVSN 198


>gi|254502107|ref|ZP_05114258.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438178|gb|EEE44857.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
          Length = 343

 Score = 37.4 bits (85), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 82/171 (47%), Gaps = 10/171 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDVIITK 80
            T  L LY+ ++      +   FEE++G+KI+ I   +     +     Q SP D+++T 
Sbjct: 27  ATGELNLYSSRHYDTDERLYSDFEEQSGIKINRIEGKADELLTRMEAEGQNSPADILLTV 86

Query: 81  DETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D + L  A    LL  + + ++++     +++++ +    S   +++ Y  +  K+A+ P
Sbjct: 87  DTSRLERAKGMGLLQSVESPVLEQRLPGYVQDDDNQWFGFSQRARIIFYDKE--KVAEPP 144

Query: 138 KSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++  DL + ++K  + I + +N+    +   + +   +  V+D+   +  N
Sbjct: 145 RTYQDLADPKYKGMICIRSSSNVYTQTITAALIEHLGEEAVKDWATAVVGN 195


>gi|325141858|gb|EGC64302.1| Major ferric iron-binding protein precursor [Neisseria meningitidis
           961-5945]
          Length = 229

 Score = 37.4 bits (85), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF 161
           K  + +S  ++V+ Y T+++   DL KSV +    +WK R+  AP + +F
Sbjct: 13  KDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYAPTSGAF 62


>gi|115351147|ref|YP_772986.1| extracellular solute-binding protein [Burkholderia ambifaria AMMD]
 gi|115281135|gb|ABI86652.1| extracellular solute-binding protein, family 1 [Burkholderia
           ambifaria AMMD]
          Length = 347

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTQQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLAQPVRSKVLDDAIPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|225677346|ref|ZP_03788319.1| iron compound ABC transporter, periplasmic iron [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590614|gb|EEH11868.1| iron compound ABC transporter, periplasmic iron [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 341

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 81/180 (45%), Gaps = 28/180 (15%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQGSPVDVIITK 80
           N ++ + +Y+ + + ++  +   F + TG+K+  I   Y+  + R  +  G   D+ +T 
Sbjct: 28  NDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQLLSR--MENGGEADLFLTA 85

Query: 81  DETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD--------TQVLAYSTKRIK 132
           D  +L     +L K    L + +S VLK+      R S D         ++L Y+ + + 
Sbjct: 86  DAINL-----ILAKKRGLLSQVDSGVLKSVIPARFRDSEDYWFGLTKRARILVYNKESVD 140

Query: 133 IADLPKSVFDLTNAQWKKRL----SIAPNN---ISFHRLLNTMEQTPNKTVVQDFIKNIT 185
             DL  +  DL N +WK ++    S +P N   I+F    N  E+T  K  V   + N+ 
Sbjct: 141 PKDLS-TYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKT--KEWVSGIVSNMA 197


>gi|15600410|ref|NP_253904.1| binding protein component of ABC iron transporter [Pseudomonas
           aeruginosa PAO1]
 gi|107104319|ref|ZP_01368237.1| hypothetical protein PaerPA_01005393 [Pseudomonas aeruginosa PACS2]
 gi|116053365|ref|YP_793689.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254238086|ref|ZP_04931409.1| hypothetical protein PACG_04202 [Pseudomonas aeruginosa C3719]
 gi|254243901|ref|ZP_04937223.1| hypothetical protein PA2G_04730 [Pseudomonas aeruginosa 2192]
 gi|296392074|ref|ZP_06881549.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PAb1]
 gi|313110287|ref|ZP_07796179.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa 39016]
 gi|76363283|sp|Q9HTX3|P5217_PSEAE RecName: Full=Probable binding protein component of ABC iron
           transporter PA5217; Flags: Precursor
 gi|9951524|gb|AAG08602.1|AE004934_9 probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PAO1]
 gi|115588586|gb|ABJ14601.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170017|gb|EAZ55528.1| hypothetical protein PACG_04202 [Pseudomonas aeruginosa C3719]
 gi|126197279|gb|EAZ61342.1| hypothetical protein PA2G_04730 [Pseudomonas aeruginosa 2192]
 gi|310882681|gb|EFQ41275.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa 39016]
          Length = 332

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 82/174 (47%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ +   ++ P+  ++  +TGVK+   + +  + P + +       +P D+++T D 
Sbjct: 25  VVVYSSRIDELIKPVFDAYTSKTGVKVK--FITDKEAPLMARIKAEGANTPADLLLTVDA 82

Query: 83  TSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L   E   LL    +  I++N     ++       +S   + + YST+R+K  +L  S
Sbjct: 83  GNLWQAEQMGLLQPFKSATIERNIPSQYRSSTDSWTGLSLRARTIVYSTERVKPEEL--S 140

Query: 140 VFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
            ++ L + QW+ RL +      +++     L+ T      + ++Q ++ N+  +
Sbjct: 141 TYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNNLATD 194


>gi|170702282|ref|ZP_02893181.1| extracellular solute-binding protein family 1 [Burkholderia
           ambifaria IOP40-10]
 gi|170132814|gb|EDT01243.1| extracellular solute-binding protein family 1 [Burkholderia
           ambifaria IOP40-10]
          Length = 347

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTQQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLAQPVRSKVLDDAIPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|254672295|emb|CBA05384.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha275]
          Length = 223

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF 161
           K  + +S  ++V+ Y T+++   DL KSV +    +WK R+  AP + +F
Sbjct: 7   KDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYAPTSGAF 56


>gi|172060148|ref|YP_001807800.1| extracellular solute-binding protein [Burkholderia ambifaria
           MC40-6]
 gi|171992665|gb|ACB63584.1| extracellular solute-binding protein family 1 [Burkholderia
           ambifaria MC40-6]
          Length = 347

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTQQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLAQPVRSKVLDDAIPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|50120409|ref|YP_049576.1| ABC transporter substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610935|emb|CAG74380.1| ABC transporter, substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 349

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 75/145 (51%), Gaps = 18/145 (12%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVD 75
           A + E++   LTLYT +   ++ P++ +F + T VK++ ++     ++R     Q SP D
Sbjct: 29  AVAAEDS---LTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKDGMLERVKAEGQNSPAD 85

Query: 76  VIITKDETSLALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTK 129
           +++T D  +L    DL+       I+ ++        L++++ +   +S  ++VL Y+ K
Sbjct: 86  LLMTVDAGNLI---DLVEAGVTQPIQSSTLTDVIPAALRDKDNQWFGLSMRSRVL-YAEK 141

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSI 154
            + +  +  +  +L + +WK ++ I
Sbjct: 142 SLPLTGI--TYENLADPKWKGKVCI 164


>gi|218894319|ref|YP_002443189.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa LESB58]
 gi|218774548|emb|CAW30365.1| probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa LESB58]
          Length = 332

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 82/174 (47%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ +   ++ P+  ++  +TGVK+   + +  + P + +       +P D+++T D 
Sbjct: 25  VVVYSSRIDELIKPVFDAYTSKTGVKVK--FITDKEAPLMARIKAEGANTPADLLLTVDA 82

Query: 83  TSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L   E   LL    +  I++N     ++       +S   + + YST+R+K  +L  S
Sbjct: 83  GNLWQAEQMGLLQPFKSATIERNIPSQYRSSTDSWTGLSLRARTIVYSTERVKPEEL--S 140

Query: 140 VFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
            ++ L + QW+ RL +      +++     L+ T      + ++Q ++ N+  +
Sbjct: 141 TYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNNLATD 194


>gi|330501302|ref|YP_004378171.1| putative binding protein component of ABC iron transporter
           [Pseudomonas mendocina NK-01]
 gi|328915588|gb|AEB56419.1| putative binding protein component of ABC iron transporter
           [Pseudomonas mendocina NK-01]
          Length = 333

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 82/174 (47%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ +   ++ P+  ++  +TGVK+   + +  + P I +       +P D++IT D 
Sbjct: 26  VVVYSSRIDELIKPVFDAYTAKTGVKVK--FITDKEAPLIARLKAEGANTPADMLITVDA 83

Query: 83  TSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L  A  E +L    + +I  N     ++       +S   + + YST+R+K  +L  S
Sbjct: 84  GNLWQAEQEGVLQPTKSDVIDANIPAQYRSSTDSWTGLSLRARTIFYSTERVKPEEL--S 141

Query: 140 VFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
            ++ L +  W+ RL +  +   +++     L+ T      + +V+ ++ N+  +
Sbjct: 142 TYEALADKNWEGRLCLRTSKKVYNQSLTATLIETHGAEKTEEIVKGWVNNLATD 195


>gi|159027971|emb|CAO87134.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 351

 Score = 37.0 bits (84), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 25/178 (14%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKD 81
           TK L LY+ ++ +    +  +F  +TG+KI+ +   +   I+R     + SP D+++T D
Sbjct: 35  TKQLNLYSSRHYNTDRRLYDNFTRQTGIKINLVEGEADPLIERIKSEGRNSPADILLTVD 94

Query: 82  ETSLALNED-----------LLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
              L   +            L+ ++PAH        L++        S   +V+ Y+  R
Sbjct: 95  AGRLWRADQQGIFAPVNSPILIQRIPAH--------LRHPKGHWFGFSKRLRVIMYNKDR 146

Query: 131 IKIADLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +   ++  S  DLTN +WK + ++ + +NI        +     +   + + + + AN
Sbjct: 147 VNPREI-DSYADLTNPKWKGKVVTRSSSNIYSQSFTAWLIDIQGEAAAEKWCRGLVAN 203


>gi|227113188|ref|ZP_03826844.1| ABC transporter, substrate binding protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 349

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVDVIITKDETSL 85
           LTLYT +   ++ P++ +F + T VK++ ++     ++R     Q SP D+++T D  +L
Sbjct: 36  LTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKDGMLERVKAEGQNSPADLLMTVDAGNL 95

Query: 86  ALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       I+ ++        L++++ +   +S   +VL Y+ K + +      
Sbjct: 96  I---DLVEAGVTQPIQSSALTEAIPAALRDKDNQWFGLSMRARVL-YAEKGLAVDSFHYE 151

Query: 140 VFDLTNAQWKKRLSI 154
             DL + +WK ++ +
Sbjct: 152 --DLADPKWKGKVCL 164


>gi|119490211|ref|ZP_01622724.1| iron binding protein component of ABC iron transporter [Lyngbya sp.
           PCC 8106]
 gi|119454097|gb|EAW35250.1| iron binding protein component of ABC iron transporter [Lyngbya sp.
           PCC 8106]
          Length = 350

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 81/169 (47%), Gaps = 13/169 (7%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVIITKDETS 84
           + LY+ ++      + + F ++TG+K++ +   + Q      ++G  SP DV+IT D  +
Sbjct: 37  INLYSSRHYDTDNQLYNGFTQKTGIKVNLVEGDAAQLIERIKSEGANSPADVLITVDAGN 96

Query: 85  L--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           L  A  E +   + + ++  N+ +   L++   +   +S   +V+ Y+   +  A L  S
Sbjct: 97  LWRAQQEGIFQPVSSSVL--NNAIPANLRDPENRWFGLSKRARVIMYNKNNVNPAQL-SS 153

Query: 140 VFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + +WK ++ I + NNI    L+ ++ +       + + K   +N
Sbjct: 154 YEDLADPKWKGKVVIRSSNNIYNQSLVASLLEVHGAADTEKWAKGFVSN 202


>gi|313889897|ref|ZP_07823538.1| ABC transporter, solute-binding protein [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313121745|gb|EFR44843.1| ABC transporter, solute-binding protein [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 344

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (43%), Gaps = 23/190 (12%)

Query: 11  LLLCGFTEAFSTE-NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRP 66
           L  CG       E   +  L +Y+  ++ ++   I +FEE+ G+K+  I   +    ++ 
Sbjct: 18  LAACGSKAGNKKEAKGSDKLVVYSPNSEGLINATIPAFEEKYGIKVELIQAGTGELFKKV 77

Query: 67  PITQGSPV-DVIITKDETSLALNEDLLHKLPAHLIKKNSFVLK---NENKKLMRISFDTQ 122
                 PV DV+     T  A + +L  K  A   K N  V+K   N        + D  
Sbjct: 78  ESEASKPVADVVFGGSYTQYAQHPELFEKYTA---KDNDKVIKDYQNTTGYSTPYTLDGS 134

Query: 123 VLAYS---TKRIKIADLPKSVFDLTNAQWKKRLSIA-PNNIS--FHRLLNTMEQTP--NK 174
           VL  +   TK +KI    K   DL N + K +++ A P N S  F +L N ++ T   +K
Sbjct: 135 VLIVNPDLTKGMKI----KGYKDLLNPELKGKIATADPANSSSAFAQLTNMLKATGGYDK 190

Query: 175 TVVQDFIKNI 184
               D++K++
Sbjct: 191 KAAWDYVKDL 200


>gi|58697102|ref|ZP_00372545.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698469|ref|ZP_00373376.1| iron compound ABC transporter, periplasmic iron-compound-binding
           protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630580|ref|YP_002727371.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia sp. wRi]
 gi|58535008|gb|EAL59100.1| iron compound ABC transporter, periplasmic iron-compound-binding
           protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536611|gb|EAL59938.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592561|gb|ACN95580.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia sp. wRi]
          Length = 341

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 81/180 (45%), Gaps = 28/180 (15%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQGSPVDVIITK 80
           N ++ + +Y+ + + ++  +   F + TG+K+  I   Y+  + R  +  G   D+ +T 
Sbjct: 28  NDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQLLSR--MENGGEADLFLTA 85

Query: 81  DETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD--------TQVLAYSTKRIK 132
           D  +L     +L K    L + +S VLK+      R S D         ++L Y+ + + 
Sbjct: 86  DAINL-----ILAKKRGLLSQVDSEVLKSVIPARFRDSEDYWFGLTKRARILVYNKESVD 140

Query: 133 IADLPKSVFDLTNAQWKKRL----SIAPNN---ISFHRLLNTMEQTPNKTVVQDFIKNIT 185
             DL  +  DL N +WK ++    S +P N   I+F    N  E+T  K  V   + N+ 
Sbjct: 141 PKDLS-TYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKT--KEWVSGIVSNMA 197


>gi|107022286|ref|YP_620613.1| extracellular solute-binding protein [Burkholderia cenocepacia AU
           1054]
 gi|116689232|ref|YP_834855.1| extracellular solute-binding protein [Burkholderia cenocepacia
           HI2424]
 gi|105892475|gb|ABF75640.1| extracellular solute-binding protein, family 1 [Burkholderia
           cenocepacia AU 1054]
 gi|116647321|gb|ABK07962.1| extracellular solute-binding protein, family 1 [Burkholderia
           cenocepacia HI2424]
          Length = 347

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 79/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDVGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  + + +  K+    I  N   L+  N     +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGVTQPVRSKVLDDAIPAN---LRATNGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATETWLRGVKAN 194


>gi|296136498|ref|YP_003643740.1| extracellular solute-binding protein family 1 [Thiomonas intermedia
           K12]
 gi|295796620|gb|ADG31410.1| extracellular solute-binding protein family 1 [Thiomonas intermedia
           K12]
          Length = 328

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 70/161 (43%), Gaps = 11/161 (6%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M  + ++ + L+L  F   F+       L +Y+    S+   +   + +++G  +  +YT
Sbjct: 1   MKHKLLFAFALVLTAF---FARMANAADLVVYSSAPASLAKALAAGYAKQSGQHVD-LYT 56

Query: 61  SS----IQRPPITQGSP-VDVIITKDETS-LAL-NEDLLHKLPAHLIKKNSFVLKNENKK 113
           +S    + R       P  DV+I  D T+ LAL N+ L+       I K      N    
Sbjct: 57  ASTGKIMARLAAEAAQPHADVVILADWTAGLALANQGLVLPYRPDAILKTLRNQVNAPGP 116

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
            + +  D   L  +T  +     P+   DLTNA+WK +L++
Sbjct: 117 FLPVGADVVGLVVNTHLVGDKQAPQDWSDLTNAKWKGQLTM 157


>gi|325528544|gb|EGD05653.1| ABC transporter extracellular solute-binding protein [Burkholderia
           sp. TJI49]
          Length = 347

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 79/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L++       +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLTQPVRSKVLDDAIPAN---LRSAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEQWLRGVKAN 194


>gi|253687739|ref|YP_003016929.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754317|gb|ACT12393.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 349

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 70/135 (51%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVDVIITKDETSL 85
           LTLYT +   ++ P++ +F + T VK++ ++     ++R     Q SP D+++T D  +L
Sbjct: 36  LTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKDGMLERVKAEGQNSPADLLMTVDAGNL 95

Query: 86  ALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       I+ ++        L++++ +   +S  ++VL Y+ K + +  +  +
Sbjct: 96  I---DLVEAGVTQPIQSSTLTEVIPAALRDKDNQWFGLSMRSRVL-YAEKSLPLTGI--T 149

Query: 140 VFDLTNAQWKKRLSI 154
             +L + +WK ++ I
Sbjct: 150 YENLADPKWKGKVCI 164


>gi|171322459|ref|ZP_02911264.1| extracellular solute-binding protein family 1 [Burkholderia
           ambifaria MEX-5]
 gi|171092213|gb|EDT37602.1| extracellular solute-binding protein family 1 [Burkholderia
           ambifaria MEX-5]
          Length = 347

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K+    I  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLAQPVRSKVLDDAIPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|299770134|ref|YP_003732160.1| flavoprotein [Acinetobacter sp. DR1]
 gi|298700222|gb|ADI90787.1| flavoprotein [Acinetobacter sp. DR1]
          Length = 510

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 64/154 (41%), Gaps = 24/154 (15%)

Query: 51  TGVKISPIYTSSIQRPPITQGSPVDVII--TKDETSLALNEDLLHKLPAHLIKKNSFVLK 108
           T V + P     ++   + Q SP  VI   + D  +LALN+ L  +    +I+K +  L 
Sbjct: 193 TAVTLIPAMAKDVEHITMLQRSPSYVIAMPSVDPIALALNKVLSPQRAYEIIRKKNIALS 252

Query: 109 NENKKLMRISFDTQVLAYSTKRIKIAD----LPKSVFDLTNA------QWKKRLSIAPNN 158
               KL R   D        +R+ IAD    LPK  FD+          W +RL + P+ 
Sbjct: 253 RGMYKLSRRFPDVM------RRLLIADVKRRLPKG-FDVATHFSPKYNPWDERLCVVPDG 305

Query: 159 ISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
             F  +      +   +VV D I   T + IL K
Sbjct: 306 DMFKAI-----SSGKASVVTDHIDRFTKDGILLK 334


>gi|42520728|ref|NP_966643.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99034659|ref|ZP_01314604.1| hypothetical protein Wendoof_01000580 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410468|gb|AAS14577.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 341

 Score = 36.6 bits (83), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 81/180 (45%), Gaps = 28/180 (15%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQGSPVDVIITK 80
           N ++ + +Y+ + + ++  +   F + TG+K+  I   Y+  + R  +  G   D+ +T 
Sbjct: 28  NDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQLLSR--MENGGEADLFLTA 85

Query: 81  DETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD--------TQVLAYSTKRIK 132
           D  +L     +L K    L + +S VLK+      R S D         ++L Y+ + + 
Sbjct: 86  DAINL-----ILAKKRGLLSQVDSEVLKSVIPARFRDSEDYWFGLTKRARILVYNKESVD 140

Query: 133 IADLPKSVFDLTNAQWKKRL----SIAPNN---ISFHRLLNTMEQTPNKTVVQDFIKNIT 185
             DL  +  DL N +WK ++    S +P N   I+F    N  E+T  K  V   + N+ 
Sbjct: 141 PKDLS-TYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKT--KEWVSGIVSNMA 197


>gi|296274170|ref|YP_003656801.1| family 1 extracellular solute-binding protein [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098344|gb|ADG94294.1| extracellular solute-binding protein family 1 [Arcobacter
           nitrofigilis DSM 7299]
          Length = 335

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 79/168 (47%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG--SPVDVIITKDET 83
           + +Y+ ++      I   FE+ TG+K++ +   +   I+R   T+G  SP DV+IT D  
Sbjct: 22  VNVYSHRHYDTDKKIFKLFEKETGIKVNVVKAMADELIKRME-TEGDKSPADVLITVDAA 80

Query: 84  SL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            L  A  + LL  + +  ++KN    L++++ +   ++   +V  Y  K   I     + 
Sbjct: 81  GLYKAKTKGLLQAIKSDYLEKNIPKNLRDKDNEWFGVTIRARVAVYK-KGEGIGKELSTY 139

Query: 141 FDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            DL + ++K ++ + + NN+    LL  +     K     + K I AN
Sbjct: 140 EDLADPKYKGQIMVRSSNNVYNQSLLAAVVAHHGKEYALKWAKGIVAN 187


>gi|313501173|gb|ADR62539.1| Iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida BIRD-1]
          Length = 333

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGDNGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I +N     +  + +   +S   + + YST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIESDVIDQNIPAQYRASSHEWTGLSLRARTIIYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K  +L  S ++ L + QW+ RL +      +++     L+ T  +   + +V+ ++ N+
Sbjct: 135 VKPEEL--STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEKIVKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|120406952|ref|YP_956781.1| extracellular solute-binding protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119959770|gb|ABM16775.1| extracellular solute-binding protein, family 1 [Mycobacterium
           vanbaalenii PYR-1]
          Length = 347

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 12/143 (8%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQGSP----VDV 76
           +TE T   LT YTD +   + P++ +F E+TG++++ + T  + +  +++ +      DV
Sbjct: 38  ATEGT---LTWYTDDDAQEVDPVVRAFTEKTGIEVTLLATEFVAQRLMSESASNVATADV 94

Query: 77  IITKDETSLALNEDL--LHKLPAHL---IKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           I      S+   ED   L KLPA +   + +   V  +++         +  + Y+T  +
Sbjct: 95  ISFAGAPSVLELEDAGYLAKLPASVSEALPRQDPVFVSKSGNWFSNQASSWGVFYNTDLV 154

Query: 132 KIADLPKSVFDLTNAQWKKRLSI 154
             A  P       N  W+ + S+
Sbjct: 155 DPAFRPTDFTSFLNPYWRGKFSV 177


>gi|300825510|ref|ZP_07105574.1| bacterial extracellular solute-binding protein [Escherichia coli MS
           119-7]
 gi|300522033|gb|EFK43102.1| bacterial extracellular solute-binding protein [Escherichia coli MS
           119-7]
          Length = 324

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 30/167 (17%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           FKRT+     L   F  AFS +     +TLYT +   ++ P++ S+ + +G+ ++ +Y  
Sbjct: 14  FKRTVIPATFLFASFP-AFSQD----IVTLYTTREPGLIKPLLDSWTKSSGINVNTVYIK 68

Query: 62  SIQRPPI---TQGSPVDVIITKDETSL-----------ALNEDLLHKLPAHLIKKNSFVL 107
                 I    + SP D+++T D  +L             +E L   +PA+        L
Sbjct: 69  DGMLERIKAEGKNSPADLLMTVDAGNLIDLVEAGVTQPVESEILKTAIPAN--------L 120

Query: 108 KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
           + EN     +S   +VL Y+ K   I  L      L + ++K R+ +
Sbjct: 121 RGENNHWFALSMRARVL-YAEKNFPIDSLHYE--QLASPEYKGRVCM 164


>gi|294139549|ref|YP_003555527.1| iron(III) ABC transporter periplasmic iron(III)-binding protein
           [Shewanella violacea DSS12]
 gi|293326018|dbj|BAJ00749.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella violacea DSS12]
          Length = 335

 Score = 36.6 bits (83), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 56/99 (56%), Gaps = 9/99 (9%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPI 68
           L L+C  + A + EN    LT+Y+ +   ++ PI+  F + TG+++  +++   I    +
Sbjct: 10  LGLVCFASVANAAEN----LTVYSYRQAFLVEPILAKFTKETGIEVDVVFSKKGIAERMM 65

Query: 69  TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN 103
            +G  SP D+++T D + L   ++++L+  + + L+K N
Sbjct: 66  REGRLSPADIVLTSDFSRLMELVDKNLVIPVDSELLKTN 104


>gi|33603747|ref|NP_891307.1| putative iron(III)-binding periplasmic protein precursor
           [Bordetella bronchiseptica RB50]
 gi|33577872|emb|CAE35137.1| putative iron(III)-binding periplasmic protein precursor
           [Bordetella bronchiseptica RB50]
          Length = 373

 Score = 36.6 bits (83), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 106 VLKNENKKLMRISFDTQ-VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN 157
           VL +  K+++R  +D Q V+ Y+   +K  ++PK +++LT  +W+ R ++A N
Sbjct: 154 VLPSYRKRMLR-QWDVQYVMVYNKNLVKAGEVPKDLWELTEPKWQGRFAMANN 205


>gi|301161930|emb|CBW21474.1| conserved hypothetical protein, possible ATP/GTP-binding site
           [Bacteroides fragilis 638R]
          Length = 595

 Score = 36.6 bits (83), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQD 179
           KS F + N  W   +S A N I  +R   T+  TP KTVV+D
Sbjct: 421 KSGFGIENLTWTPEVSFAGNTIRNNRARGTLFSTPKKTVVED 462


>gi|15601916|ref|NP_244988.1| FbpA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720256|gb|AAK02135.1| FbpA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 355

 Score = 36.6 bits (83), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 82/169 (48%), Gaps = 13/169 (7%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-----IQRPPITQGSPVDVIITKDET 83
           + +Y+ +   ++ P++  FE+ TGVK++ I+        ++R    + SP DV++T D +
Sbjct: 43  VNVYSYRQPYLIEPMLKDFEKDTGVKVNVIFADKGLVDRVKRE--GELSPADVLLTVDIS 100

Query: 84  SLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK--S 139
            +   + E L   + +  ++KN    +  + K    +  T+  A  T + ++  LP   +
Sbjct: 101 RVMEIVKEGLAQPIHSETLEKN-IPAQFRDSKDEWFALTTRARAIYTAKDRVGKLPADFT 159

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            +DL   ++K ++ +     +++  L+ +M     +   + F++ + AN
Sbjct: 160 YYDLAKPEYKGKVCVRSGKNAYNVSLVASMIAHDGEAKAKAFLEGLKAN 208


>gi|218670525|ref|ZP_03520196.1| ABC transporter, substrate binding protein (iron) [Rhizobium etli
           GR56]
          Length = 261

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 67/138 (48%), Gaps = 21/138 (15%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPITQG--SPVDVIITKDETSL 85
           + LYT +  +++ P++ +F + TG K++ I+    +     ++G  SP D+++  D  +L
Sbjct: 9   INLYTTREPALIAPLLEAFTKSTGTKVNTIFLKDGLAERVASEGASSPADILMAVDAGNL 68

Query: 86  ALNEDLLHKLPAHLIKK---NSFV---LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+ K     ++    NS +   L++       +S   +VL Y+ K     DL  S
Sbjct: 69  V---DLVDKGVTQPVESSVLNSAIPEQLRDAKGNWFALSMRARVL-YAAK-----DLDIS 119

Query: 140 VF---DLTNAQWKKRLSI 154
            F   +L + +WK ++ I
Sbjct: 120 TFNYEELADPKWKGKICI 137


>gi|126728802|ref|ZP_01744617.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Sagittula stellata E-37]
 gi|126710732|gb|EBA09783.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Sagittula stellata E-37]
          Length = 334

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/176 (18%), Positives = 85/176 (48%), Gaps = 8/176 (4%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQR-PPITQGSPVD 75
           A +T    + + +Y+ +   ++ P+  +F E TG+K++  +     ++R     + SP D
Sbjct: 13  AMATPVMAQEVNVYSYRQPELLAPLTEAFTEETGIKVNVAFLEQGMVERLQAEGRRSPAD 72

Query: 76  VIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           V++T D + L   +   +   + +  + KN   +  + +K+   ++   +V+  S +R+ 
Sbjct: 73  VVLTVDISRLNAVVAAGVTQPVESDTLMKNVPAIYHDPDKQWWGLTTRARVVYASKERVA 132

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             ++  +  DL + +WK R+       +++  L++ M     +   +++++ + AN
Sbjct: 133 EGEV-TTYEDLADPKWKGRICTRSGTHAYNVALVSAMLVHHGEEYTREWLEGVKAN 187


>gi|161525263|ref|YP_001580275.1| extracellular solute-binding protein [Burkholderia multivorans ATCC
           17616]
 gi|189349999|ref|YP_001945627.1| iron(III) transporter substrate-binding protein [Burkholderia
           multivorans ATCC 17616]
 gi|160342692|gb|ABX15778.1| extracellular solute-binding protein family 1 [Burkholderia
           multivorans ATCC 17616]
 gi|189334021|dbj|BAG43091.1| iron(III) transport system substrate-binding protein [Burkholderia
           multivorans ATCC 17616]
          Length = 347

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P++ +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLLDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K     I  N   L+    +   +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLTQPIRSKALDEAIPAN---LRGAQGEWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|323968924|gb|EGB64249.1| extracellular solute-binding protein [Escherichia coli TA007]
          Length = 349

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 30/167 (17%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           FKRT+     L   F  AFS +     +TLYT +   ++ P++ S+ + +G+ ++ +Y  
Sbjct: 14  FKRTVIPATFLFASFP-AFSQD----IVTLYTTREPGLIKPLLDSWTKSSGINVNTVYIK 68

Query: 62  SIQRPPI---TQGSPVDVIITKDETSL-----------ALNEDLLHKLPAHLIKKNSFVL 107
                 I    + SP D+++T D  +L             +E L   +PA+        L
Sbjct: 69  DGMLERIKAEGKNSPADLLMTVDAGNLIDLVEAGVTQPVESEILKTAIPAN--------L 120

Query: 108 KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
           + EN     +S   +VL Y+ K   I  L      L + ++K R+ +
Sbjct: 121 RGENNHWFALSMRARVL-YAEKNFPIDSLHYE--QLASPEYKGRVCM 164


>gi|158333301|ref|YP_001514473.1| iron deficiency induced protein A [Acaryochloris marina MBIC11017]
 gi|158303542|gb|ABW25159.1| iron deficiency induced protein A [Acaryochloris marina MBIC11017]
          Length = 350

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 85/175 (48%), Gaps = 11/175 (6%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSP-VDVI 77
           T+   K + +Y+ ++      +   F ++TG+++  + +     ++R      +P  DV+
Sbjct: 30  TDGEGKIVRVYSARHYDTDQALYQDFTKQTGIEVKLLESKDNELLERIKNEASNPQADVL 89

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           IT D   L  A   +LL  + ++ +K K    L++ +     ++   ++L Y+  ++K  
Sbjct: 90  ITVDAGRLWRAEQANLLQSISSNQLKDKIPENLRHPDGLWFGLTRRVRMLVYNKAKVKPE 149

Query: 135 DLPKSVFD-LTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +L  S ++ L    WK R+ + + NNI    LL +  ++  +T  + + KN+ AN
Sbjct: 150 EL--STYEALAEPAWKGRVCVRSSNNIYNQSLLGSFIESKGETETEQWAKNLVAN 202


>gi|91226103|ref|ZP_01260993.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           [Vibrio alginolyticus 12G01]
 gi|91189337|gb|EAS75615.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           [Vibrio alginolyticus 12G01]
          Length = 251

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRP 66
           Y  L    + +FS   +T           + +  I  +FEE+  V I+P+Y  +SSI R 
Sbjct: 7   YACLTVVLSISFSANASTNLKVYAASSMTNAINEIAQNFEEKYDVSITPVYGGSSSIAR- 65

Query: 67  PITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVL 107
            I  G+P DV I+ +   +   +++D++++     + +NS VL
Sbjct: 66  QIINGAPADVFISANTKWMDYLVDKDVIYRDNVTNLVRNSLVL 108


>gi|157374084|ref|YP_001472684.1| extracellular solute-binding protein [Shewanella sediminis
          HAW-EB3]
 gi|157316458|gb|ABV35556.1| extracellular solute-binding protein, family 1 [Shewanella
          sediminis HAW-EB3]
          Length = 335

 Score = 36.2 bits (82), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 11 LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
          L + G     S  N  + LT+Y+ +   ++ PI+ +F + TG+ +  +++   I    + 
Sbjct: 7  LSILGLVCLASAANAAEKLTVYSYRQAFLIDPILENFTKETGIDVEVVFSKKGIAERMVR 66

Query: 70 QG--SPVDVIITKDETSL 85
          +G  SP D+++T D + L
Sbjct: 67 EGRLSPADIVLTSDFSRL 84


>gi|317403024|gb|EFV83562.1| ABC transporter [Achromobacter xylosoxidans C54]
          Length = 347

 Score = 36.2 bits (82), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P++ +F + +G+K++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLLDAFTKESGIKVNTVFVKDGLLERVKAEGAKSPADVLMTVDIGNL 91

Query: 86  ALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       IK  +        L+  + K   +S   +VL Y  K +K+      
Sbjct: 92  L---DLVDGGVTQSIKSQTLESVIPANLRGADGKWYALSLRDRVL-YVEKDLKLESF--R 145

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + +WK ++ I      ++  ++ +M         + +++ + AN
Sbjct: 146 YEDLADPKWKGKVCIRSGQHPYNTAMVASMIAHDGAEATEKWLRGVKAN 194


>gi|227328888|ref|ZP_03832912.1| ABC transporter, substrate binding protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 349

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 70/135 (51%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVDVIITKDETSL 85
           LTLYT +   ++ P++ +F + T VK++ ++     ++R     Q SP D+++T D  +L
Sbjct: 36  LTLYTTREPGLIQPLLDAFTKDTSVKVNTVFIKDGMLERVKAEGQNSPADLLMTVDAGNL 95

Query: 86  ALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       I+ ++        L++++ +   +S  ++VL Y+ K + +  +  +
Sbjct: 96  I---DLVDAGVTQPIQSSALTEAIPAALRDKDNQWFGLSMRSRVL-YAEKSLPLTGI--T 149

Query: 140 VFDLTNAQWKKRLSI 154
             +L + +WK ++ I
Sbjct: 150 YENLADPKWKGKVCI 164


>gi|26991872|ref|NP_747297.1| iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|24986992|gb|AAN70761.1|AE016720_4 iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
          Length = 333

 Score = 36.2 bits (82), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 84/183 (45%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGDNGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I +N     +  +     +S   + + YST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIESDVIDQNIPAQYRASSHDWTGLSLRARTIIYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K  +L  S ++ L + QW+ RL +      +++     L+ T  +   + +V+ ++ N+
Sbjct: 135 VKPEEL--STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQIVKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|269967756|ref|ZP_06181804.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           [Vibrio alginolyticus 40B]
 gi|269827662|gb|EEZ81948.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           [Vibrio alginolyticus 40B]
          Length = 251

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 43  IIHSFEERTGVKISPIY--TSSIQRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAH 98
           I  +FEE+  V I+P+Y  +SSI R  I  G+P DV I+ +   +   +++D++++    
Sbjct: 41  IAQNFEEKYDVSITPVYGGSSSIAR-QIINGAPADVFISANTKWMDYLVDKDVIYRDNVT 99

Query: 99  LIKKNSFVL 107
            + +NS VL
Sbjct: 100 NLVRNSLVL 108


>gi|167622837|ref|YP_001673131.1| extracellular solute-binding protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167352859|gb|ABZ75472.1| extracellular solute-binding protein family 1 [Shewanella
           halifaxensis HAW-EB4]
          Length = 335

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           L + G T   S  N    LT+Y+ +   ++ PI+ +F + TG+K+  +++   I    + 
Sbjct: 7   LAVIGLTCFASIANAADSLTVYSYRQAFLIEPILENFTKETGIKVDVVFSKKGIAERMMR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN 103
           +G  S  D+++T D   L   + +DL+    + ++K+N
Sbjct: 67  EGRLSKADIVLTSDFYRLMELVEKDLVVPASSDILKQN 104


>gi|167036243|ref|YP_001671474.1| extracellular solute-binding protein [Pseudomonas putida GB-1]
 gi|166862731|gb|ABZ01139.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           GB-1]
          Length = 333

 Score = 35.8 bits (81), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 84/183 (45%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGDNGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I +N     +  +     +S   + + YST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIKSDIIDQNIPPQYRASSHDWTGLSLRARTIIYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K  +L  S ++ L + QW+ RL +      +++     L+ T  +   + VV+ ++ N+
Sbjct: 135 VKPEEL--STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQVVKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|206559478|ref|YP_002230239.1| ABC transporter extracellular solute-binding protein [Burkholderia
           cenocepacia J2315]
 gi|198035516|emb|CAR51395.1| ABC transporter extracellular solute-binding protein [Burkholderia
           cenocepacia J2315]
          Length = 347

 Score = 35.8 bits (81), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDVGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  + + +  K     I  N   L+  N     +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGVTQPVRSKALDDAIPAN---LRATNGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATETWLRGVKAN 194


>gi|66043514|ref|YP_233355.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|63254221|gb|AAY35317.1| extracellular solute-binding protein, family 1 [Pseudomonas
           syringae pv. syringae B728a]
          Length = 333

 Score = 35.8 bits (81), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
           ST      + +Y+ +   ++ P+  ++   TGVKI  I   + +  P+ Q        + 
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFI---TDKEAPLMQRIKAEGENAT 74

Query: 74  VDVIITKDETSLALNE--DLLHKLPAHLIKKNSF-VLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E   +L    + +I+ N     ++ +     +S   + +AYST R
Sbjct: 75  ADLLLTVDAGNLWQAERMGILQPFTSPVIEANILPQYRSSSHGWTGLSLRARTIAYSTDR 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K A+L  S ++ L +  W+ RL +      +++     L+ T     ++ +++ ++ N+
Sbjct: 135 VKPAEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|330901948|gb|EGH33287.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 319

 Score = 35.8 bits (81), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 83/180 (46%), Gaps = 15/180 (8%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDV 76
           ST      + +Y+ +   ++ P+  ++   TGVKI  I       +QR     Q +  D+
Sbjct: 4   STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGQNATADL 63

Query: 77  IITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L   E +  L    + +I+ N     ++       +S   + +AYST R+K 
Sbjct: 64  LLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVKP 123

Query: 134 ADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
           A+L  S ++ L +  W+ RL +      +++     L+ T     ++ +++ ++ N++ +
Sbjct: 124 AEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNLSTD 181


>gi|71282244|ref|YP_267761.1| iron(III) ABC transporter periplasmic iron(III)-binding protein
           [Colwellia psychrerythraea 34H]
 gi|71147984|gb|AAZ28457.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Colwellia psychrerythraea 34H]
          Length = 335

 Score = 35.8 bits (81), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 92/193 (47%), Gaps = 21/193 (10%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSI 63
           T++  L  +  F+ + S E     + +Y+ +   ++ P+   F E+TG+K++ ++    +
Sbjct: 7   TLFIALFFMANFSASASDE-----VNVYSYRQPFLVEPLFTQFTEQTGIKVNVVFAKKGM 61

Query: 64  QRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
                 +G  SP D+++T D + L    ++DL+  + + ++  NS   + + +     + 
Sbjct: 62  AERLAREGKYSPADILLTTDISRLIELRDKDLVQAVNSPVL-SNSIPKQYQAQDNTWFAL 120

Query: 120 DTQVL-AYSTKRIKIADLPKSVFDLTNAQWKKRLSIA----PNNISFHRLLNTMEQTPNK 174
            T+V   YS KR+   D+  +  DL N ++K R+       P N++   L+ +M     +
Sbjct: 121 TTRVRNIYSAKRLGKIDI--NYEDLANEKYKGRICTRSGKHPYNVA---LVASMISEHGE 175

Query: 175 TVVQDFIKNITAN 187
               D++K +  N
Sbjct: 176 AYTLDWLKKVKNN 188


>gi|113866786|ref|YP_725275.1| ABC transporter periplasmic protein [Ralstonia eutropha H16]
 gi|113525562|emb|CAJ91907.1| ABC-type transporter, periplasmic component: FeTfamily [Ralstonia
           eutropha H16]
          Length = 345

 Score = 35.8 bits (81), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 77/180 (42%), Gaps = 31/180 (17%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSPVDVIIT 79
           K L LYT ++      +  +F ++TG+KI+ I     Q  P+ +        SP DV IT
Sbjct: 29  KVLNLYTARHYQTDEALYANFTKQTGIKINRIEG---QEDPLLERIRNEGANSPADVFIT 85

Query: 80  KDETSLALNED-----------LLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            D   L   +            L  ++PA+         ++ N +    S   +V+AY+ 
Sbjct: 86  VDIGRLWRAQQAGVFAPVKSKALESRIPAN--------YRDPNGEWFGFSARGRVIAYNK 137

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             +K  D+  S  DL + +WK ++    +   ++  L++++     +   + + + + AN
Sbjct: 138 TAVKAGDIA-SYEDLADPKWKGKVCTRSSGHVYNLSLVSSLIAHDGEARTEQWARGVAAN 196


>gi|148550303|ref|YP_001270405.1| extracellular solute-binding protein [Pseudomonas putida F1]
 gi|148514361|gb|ABQ81221.1| extracellular solute-binding protein, family 1 [Pseudomonas putida
           F1]
          Length = 333

 Score = 35.8 bits (81), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 84/183 (45%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGDNGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I +N     +  +     +S   + + YST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIESDVIDQNIPSQYRASSHDWTGLSLRARTIIYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K  +L  S ++ L + QW+ RL +      +++     L+ T  +   + +V+ ++ N+
Sbjct: 135 VKPEEL--STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQIVKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|218246285|ref|YP_002371656.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           8801]
 gi|257059332|ref|YP_003137220.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
 gi|218166763|gb|ACK65500.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8801]
 gi|256589498|gb|ACV00385.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
          Length = 365

 Score = 35.8 bits (81), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 75/167 (44%), Gaps = 9/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKDETS 84
           L LY+ ++ +    +   F + TG+K++ I       I+R     + SP D++IT D   
Sbjct: 52  LNLYSSRHYNTDNELYQGFTQETGIKVNLIEGKDDELIERIQSEGENSPADILITVDVAR 111

Query: 85  LALNEDLLHKLPAH---LIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L   ++     P     L +K    L+         +   +V+ Y+  ++K  DL  +  
Sbjct: 112 LWRAQEAGIFTPISSPILTEKIPPSLREPEGLWFGFTKRARVIMYNKNKVKPEDL-STYE 170

Query: 142 DLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           DL N +WK R+ + P +N+    L+ ++     +   +++ + + AN
Sbjct: 171 DLANPKWKGRIIVRPSSNVYNQSLVASLIVAHGEAKTEEWCRGLVAN 217


>gi|170725358|ref|YP_001759384.1| extracellular solute-binding protein [Shewanella woodyi ATCC
          51908]
 gi|169810705|gb|ACA85289.1| extracellular solute-binding protein family 1 [Shewanella woodyi
          ATCC 51908]
          Length = 335

 Score = 35.8 bits (81), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 11 LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
          L + G     S  N    LT+Y+ +   ++ PI++ F + TG+ +  +++   I    + 
Sbjct: 7  LAVLGLVCFASVANAADKLTVYSYRQAFLIDPILNDFTKETGIDVDVVFSKKGIAERMMR 66

Query: 70 QG--SPVDVIITKD 81
          +G  SP DV++T D
Sbjct: 67 EGRLSPADVVLTSD 80


>gi|260431831|ref|ZP_05785802.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415659|gb|EEX08918.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 337

 Score = 35.8 bits (81), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 70/144 (48%), Gaps = 9/144 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG-SPVDVIITKDETS 84
           L LY+ ++      +   FEE TG+KI+ I   +   I R       SP DV++T D + 
Sbjct: 25  LNLYSSRHYDTDERLYTDFEEATGIKINRIEGKADELIARMEAEGANSPADVLLTVDTSR 84

Query: 85  LAL--NEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           LA   N  LL  + + ++++     L++E+ +    S   +++ Y   +  + + P +  
Sbjct: 85  LARAKNAGLLQAVDSDVLEERIPANLQDEDNQWFGFSQRARIIFYD--KNDVTNPPATYL 142

Query: 142 DLTNAQWKKRLSIAPNNISFHRLL 165
           DL N ++K  + I  +  ++++ L
Sbjct: 143 DLANPEYKGLVCIRSSTNTYNQTL 166


>gi|157960672|ref|YP_001500706.1| extracellular solute-binding protein [Shewanella pealeana ATCC
           700345]
 gi|157845672|gb|ABV86171.1| extracellular solute-binding protein family 1 [Shewanella pealeana
           ATCC 700345]
          Length = 335

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 5/98 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           L + G     S  N    LT+Y+ +   ++ PI+ +F + TGVK+  +++   I    + 
Sbjct: 7   LAVIGLACFASIANAADRLTVYSYRQAFLIDPILENFTKETGVKVDVVFSKKGIAERMVR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN 103
           +G  S  D+++T D   L   + +DL+    + ++K+N
Sbjct: 67  EGRLSKADIVLTSDFYRLMELVEKDLVVPASSDILKQN 104


>gi|163856595|ref|YP_001630893.1| putative iron binding protein [Bordetella petrii DSM 12804]
 gi|163260323|emb|CAP42625.1| putative iron binding protein [Bordetella petrii]
          Length = 346

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P++ +F + +G+K++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPMLDAFTKESGIKVNTVFIKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ALNEDLLHKLPAHLIKK---NSFV---LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       +K    NS +   L+  + +   +S   +VL Y    +K+      
Sbjct: 92  V---DLVDGGVTQPVKSDALNSVIPANLRGADGQWYALSLRDRVL-YVANDVKLDSF--H 145

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + QWK ++ I      ++  L+  M         + +++ + AN
Sbjct: 146 YEDLADPQWKNKVCIRSGQHPYNTGLVAAMIAHDGAQATEQWLRGVKAN 194


>gi|289674449|ref|ZP_06495339.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. syringae FF5]
 gi|330977313|gb|EGH77266.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 333

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 83/180 (46%), Gaps = 15/180 (8%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDV 76
           ST      + +Y+ +   ++ P+  ++   TGVKI  I       +QR     Q +  D+
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGQNATADL 77

Query: 77  IITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L   E +  L    + +I+ N     ++       +S   + +AYST R+K 
Sbjct: 78  LLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVKP 137

Query: 134 ADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
           A+L  S ++ L +  W+ RL +      +++     L+ T     ++ +++ ++ N++ +
Sbjct: 138 AEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNLSTD 195


>gi|260362189|ref|ZP_05775179.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           K5030]
 gi|308111054|gb|EFO48594.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           K5030]
          Length = 322

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 85/177 (48%), Gaps = 13/177 (7%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVI 77
           ST    + + +Y+ +   ++ P+ + F + TG+K++  +        + Q    SP DV+
Sbjct: 2   STAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKEGLAEKLAQEGEYSPADVV 61

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           +T D + LA   N+ L+ K+ + +I++N     +++  +   ++  T+ +  S  R+   
Sbjct: 62  LTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRTRSVYSSRDRVGKL 121

Query: 135 DLPKSVFDLTNAQWKKRLSIA----PNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
               +  DL   ++K ++       P N+S   L+++M     +   +++++ + AN
Sbjct: 122 GADFNYADLAKPEYKGKICTRSGKHPYNVS---LVSSMIAHYGEAETKEWLEGVKAN 175


>gi|170079102|ref|YP_001735740.1| iron transport protein [Synechococcus sp. PCC 7002]
 gi|169886771|gb|ACB00485.1| iron transport protein [Synechococcus sp. PCC 7002]
          Length = 363

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 89/177 (50%), Gaps = 21/177 (11%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQG--SPVDVIIT 79
            T  + LY+ ++      +  +F E TG++++ I  S    ++R   T+G  SP DV+IT
Sbjct: 44  ATGEINLYSSRHYDSDAELYEAFSEATGIEVNLIEGSDDELLERIR-TEGENSPADVLIT 102

Query: 80  KDETSL--ALNEDLLHKLPAHL----IKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            D   L  A  + LL    + +    I +N   L++ +     ++   +++ Y+T+ +  
Sbjct: 103 VDVARLWRAQQDGLLQPTESEVLTSAIPEN---LRSSDNTWFGLTKRARIIVYNTETVDP 159

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLL---NTMEQTPNKTVVQDFIKNITAN 187
           A+L  +  DL + +W+ R+ +  ++ ++++ L     +E+    T  +++++ + AN
Sbjct: 160 AEL-STYEDLADPKWEGRVCVRSSSNTYNQSLVAAKIVEKGAEAT--EEWVQGLVAN 213


>gi|145633694|ref|ZP_01789420.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           3655]
 gi|145635495|ref|ZP_01791195.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittAA]
 gi|144985454|gb|EDJ92275.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           3655]
 gi|145267260|gb|EDK07264.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittAA]
          Length = 332

 Score = 35.8 bits (81), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 81/177 (45%), Gaps = 8/177 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVI 77
           + N+   +T+Y  Q++   + +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAAVAVAKAFEQETGIKVTLNSGKSAQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA-LNE-DLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A L+E  LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKL 194


>gi|152983951|ref|YP_001351278.1| putative iron ABC transporter binding protein subunit [Pseudomonas
           aeruginosa PA7]
 gi|150959109|gb|ABR81134.1| probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PA7]
          Length = 332

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 81/174 (46%), Gaps = 19/174 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ +   ++ P+  ++  +TGVK+   + +  + P + +       +P D+++T D 
Sbjct: 25  VVVYSSRIDELIKPVFDAYTSKTGVKVR--FITDKEAPLMARIKAEGANTPADLLLTVDA 82

Query: 83  TSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L   E   LL    +  I+ N     ++       +S   + + YST+R+K  +L  S
Sbjct: 83  GNLWQAEQMGLLQPFKSATIEGNIPPQYRSSTDSWTGLSLRARTIVYSTERVKPEEL--S 140

Query: 140 VFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNITAN 187
            ++ L + QW+ RL +      +++     L+ T      + ++Q ++ N+  +
Sbjct: 141 TYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNNLATD 194


>gi|304437439|ref|ZP_07397398.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304369695|gb|EFM23361.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 351

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 48/89 (53%), Gaps = 6/89 (6%)

Query: 10  LLLLCGFT--EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQ 64
           +L  CG    +  +     K LT+YT +++S+   +I +FE+ TG+K++ I   +   ++
Sbjct: 20  MLAGCGGGTDKKAAGGEEEKVLTVYTARSESLNNLVIPNFEKDTGIKVNVIVAGTGPLLK 79

Query: 65  RPPITQGSP-VDVIITKDETSLALNEDLL 92
           R    +G+P  D++   D+ +L   +DL 
Sbjct: 80  RVASEKGNPQGDILWASDQMTLESQKDLF 108


>gi|238927525|ref|ZP_04659285.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas flueggei ATCC 43531]
 gi|238884807|gb|EEQ48445.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas flueggei ATCC 43531]
          Length = 351

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 48/89 (53%), Gaps = 6/89 (6%)

Query: 10  LLLLCGFT--EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQ 64
           +L  CG    +  +     K LT+YT +++S+   +I +FE+ TG+K++ I   +   ++
Sbjct: 20  MLAGCGGGTDKKAAGGEEEKVLTVYTARSESLNNLVIPNFEKDTGIKVNVIVAGTGPLLK 79

Query: 65  RPPITQGSP-VDVIITKDETSLALNEDLL 92
           R    +G+P  D++   D+ +L   +DL 
Sbjct: 80  RVASEKGNPQGDILWASDQMTLESQKDLF 108


>gi|190404358|ref|YP_001960989.1| rcorf14 [Agrobacterium rhizogenes]
 gi|158322154|gb|ABW33571.1| rcorf14 [Agrobacterium rhizogenes]
          Length = 362

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 74/189 (39%), Gaps = 15/189 (7%)

Query: 2   FKRTIYTYLLLL--CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
           F + I    +L+  C  +     +     ++ +       M   + SFE+   VK++ + 
Sbjct: 27  FGKAIVGGAMLVAACALSSGAQAQQKELIVSGFGGAYDEAMAASVKSFEQENDVKVTIVA 86

Query: 60  TSSIQRPPITQGSPVDVIITKDETSLALN-EDLLHKLPAHLIKKNSFVLKNE--NKKLMR 116
            S        +   VDVI++    +L +  E     L   L+     +  N   +  ++ 
Sbjct: 87  GSGANNIARVRNKEVDVIVSDPVFALRMEAEKAFAPLDPKLVTNLKDIHPNAIYSDAVVA 146

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI---APNNIS----FHRLLNTME 169
            +F   VLAY+   +K    P+S  DL   ++K R+++    P NI     F +     E
Sbjct: 147 ANFGAYVLAYNPAEVK---PPQSWHDLAKPEYKGRIALRGFRPENIDLITLFAKEAGGDE 203

Query: 170 QTPNKTVVQ 178
           + P+    +
Sbjct: 204 RHPDAGFAE 212


>gi|226946737|ref|YP_002801810.1| iron ABC transporter periplasmic iron-binding protein [Azotobacter
           vinelandii DJ]
 gi|226721664|gb|ACO80835.1| iron ABC transporter, periplasmic iron-binding protein [Azotobacter
           vinelandii DJ]
          Length = 334

 Score = 35.4 bits (80), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 67/136 (49%), Gaps = 14/136 (10%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ------GSPVDVIITKDE 82
           + +Y+ +   ++ P+  ++   TGVK+   + +  + P I +       +P D++IT D 
Sbjct: 27  IVVYSSRIDELIKPVFDAYTAETGVKVK--FITDKEAPLIARLKAEGKNTPADLLITVDA 84

Query: 83  TSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L  A  E +L  + + ++K N     ++       +S   + + YST+R++  +L  S
Sbjct: 85  GNLWQAEQEGVLRPIDSPVVKANIPPQYRSATGAWSGLSLRARTIFYSTERVRPEEL--S 142

Query: 140 VFD-LTNAQWKKRLSI 154
            ++ L +  W+ RL +
Sbjct: 143 TYEALADENWEGRLCL 158


>gi|254454365|ref|ZP_05067802.1| extracellular solute-binding protein, family 1 [Octadecabacter
           antarcticus 238]
 gi|198268771|gb|EDY93041.1| extracellular solute-binding protein, family 1 [Octadecabacter
           antarcticus 238]
          Length = 338

 Score = 35.4 bits (80), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M  RTI    LLLC    AF+       L LY+ ++      +  +FE+ TG+KI+ I  
Sbjct: 1   MTTRTITLATLLLCTAAPAFAD----GELNLYSSRHYDTDERLYSNFEDATGIKINRIEG 56

Query: 61  SS---IQRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIK 101
           ++   I R    +G  SP DV++T D + L  A N  +L  + + +++
Sbjct: 57  NADELIARME-AEGVNSPADVLLTVDTSRLERAKNAAVLQSIDSEILE 103


>gi|170724178|ref|YP_001751866.1| extracellular solute-binding protein [Pseudomonas putida W619]
 gi|169762181|gb|ACA75497.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           W619]
          Length = 333

 Score = 35.4 bits (80), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 83/183 (45%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
            T      + +Y+ +   ++ P+  ++   TGVKI  I   + +  P+ Q          
Sbjct: 18  GTAQAADEVVVYSSRIDELIKPVFDAYTAETGVKIKFI---TDKEAPLMQRIKAEGENGV 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L  + + +I +N     +  +     +S   + + YST+R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPIKSAIIDQNIPAQYRASSHDWTGLSLRARTIIYSTER 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K A+L  S ++ L + QW+ RL +      +++     L+    +   + +V+ ++ N+
Sbjct: 135 VKPAEL--STYEALADKQWEGRLCLRTAKKVYNQSLTATLIENHGEAKTEQIVKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|163796271|ref|ZP_02190232.1| extracellular solute-binding protein, family 1 [alpha
           proteobacterium BAL199]
 gi|159178413|gb|EDP62955.1| extracellular solute-binding protein, family 1 [alpha
           proteobacterium BAL199]
          Length = 344

 Score = 35.4 bits (80), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/171 (18%), Positives = 81/171 (47%), Gaps = 8/171 (4%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQG-SPVDVIITK 80
           +  + + +Y+ +   ++ P++ +F E+TG+K + ++     ++R       SP DVI+T 
Sbjct: 27  SAAEEVNVYSLRQPFLIEPLLKAFAEQTGIKTNVVFAKEGVVERMKAEGANSPADVILTV 86

Query: 81  DETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D   L  A+   ++  + +  ++ N     ++   +   ++   +++  S  R+K+ ++ 
Sbjct: 87  DIGRLNDAVEAGVIQPVKSATLEANIPANFRDPEGRWFALTQRARLIYASKDRVKLGEI- 145

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            S  +L + +WK R+        ++  LL  M     +   ++++  + AN
Sbjct: 146 TSYEELADPKWKGRICTRSGKHDYNVALLAAMIAHHGEAKAEEWLNGVKAN 196


>gi|221201435|ref|ZP_03574474.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD2M]
 gi|221208010|ref|ZP_03581016.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD2]
 gi|221214005|ref|ZP_03586978.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD1]
 gi|221166182|gb|EED98655.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD1]
 gi|221172195|gb|EEE04636.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD2]
 gi|221178703|gb|EEE11111.1| extracellular solute-binding protein, family 1 [Burkholderia
           multivorans CGD2M]
          Length = 347

 Score = 35.4 bits (80), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 77/172 (44%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P++ +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLLDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L + +  K     +  N   L+        +S   +VL Y  K +K+      
Sbjct: 92  LDLVDGGLTQPIRSKALDEAVPAN---LRGAQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|320527802|ref|ZP_08028970.1| bacterial extracellular solute-binding protein [Solobacterium
           moorei F0204]
 gi|320131739|gb|EFW24301.1| bacterial extracellular solute-binding protein [Solobacterium
           moorei F0204]
          Length = 330

 Score = 35.4 bits (80), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 46/131 (35%), Gaps = 1/131 (0%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR-PPITQGSPVDVIITKDETS 84
           T  L ++T     V  PII  FE RTG+ +      + +    I  G   DV+   D  +
Sbjct: 35  TNRLIVFTSHKSEVYAPIIKEFELRTGISVEVQAGGTTEMLGKIKNGEEADVMFGGDIQN 94

Query: 85  LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLT 144
                D +    A       F     +      S    V  Y+ K +     P+   D  
Sbjct: 95  YTYYNDYIEPYVASESSSLDFRYLEHHDSYTFFSQLPLVFIYNNKLVNNQRAPQKWSDFC 154

Query: 145 NAQWKKRLSIA 155
           +  WK ++S A
Sbjct: 155 DKSWKGKISFA 165


>gi|1573048|gb|AAC21773.1| iron(III) ABC transporter, periplasmic-binding protein (hitA)
           [Haemophilus influenzae Rd KW20]
          Length = 294

 Score = 35.4 bits (80), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 69/153 (45%), Gaps = 8/153 (5%)

Query: 43  IIHSFEERTGVKISPIYTSSIQRPPI--TQG--SPVDVIITKDETSLA-LNE-DLLHKLP 96
           +  +FE+ TG+K++     S Q       +G  +P DV  T+   + A L+E  LL  + 
Sbjct: 1   MAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPIS 60

Query: 97  AHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
              I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV D    +WK ++  
Sbjct: 61  EQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGY 120

Query: 155 APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              + +F   +  + +     V  +++K +  N
Sbjct: 121 VSTSGAFLEQVVALSKMKGDKVALNWLKGLKEN 153


>gi|126657922|ref|ZP_01729075.1| iron transport protein [Cyanothece sp. CCY0110]
 gi|126620862|gb|EAZ91578.1| iron transport protein [Cyanothece sp. CCY0110]
          Length = 341

 Score = 35.4 bits (80), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 79/171 (46%), Gaps = 9/171 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITK 80
           TT  + LY+ ++ +    +   F + TG+K++ +  S+   I+R       +  D+++T 
Sbjct: 24  TTGEVNLYSSRHYNTDTELYEGFTQETGIKVNLVEGSADELIERIKSEGDNTQADILMTV 83

Query: 81  DETSLALNEDLLHKLP---AHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D   L   E+     P   A L ++    L+N        +   +V+ Y+  ++   +L 
Sbjct: 84  DVARLWRAEEAGIFAPTTSAILEERIPASLRNPEGLWFGFTKRARVIMYNQDKVNPEEL- 142

Query: 138 KSVFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +  DL + +WK R+ I P +NI    L+ ++ +   +   ++++K   AN
Sbjct: 143 STYEDLADPKWKGRIIIRPSSNIYNQSLVASLIEAHGEEQTEEWVKGFVAN 193


>gi|319778252|ref|YP_004129165.1| Ferric iron ABC transporter, iron-binding protein [Taylorella
           equigenitalis MCE9]
 gi|317108276|gb|ADU91022.1| Ferric iron ABC transporter, iron-binding protein [Taylorella
           equigenitalis MCE9]
          Length = 337

 Score = 35.4 bits (80), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 79/178 (44%), Gaps = 34/178 (19%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPITQG--SPVDVIITKDETSL 85
           + +YT +   ++ PI+ +FE+ TG+K   ++    +     ++G  SP DV++  D + L
Sbjct: 27  VNIYTTREPGLLKPILEAFEKDTGIKAETVFVKDGLAERVESEGDKSPADVLMVVDISQL 86

Query: 86  ------ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
                  L +    K+   +I +     ++ N     +S   +VL Y+ K     D+P  
Sbjct: 87  TNLVERGLTQPTDSKVLTEVIPEQ---YRDPNNHWFALSLRYRVL-YARK-----DMPLD 137

Query: 140 VF---DLTNAQWKKRLSIAPNNISFHRLL-------NTMEQTPNKTVVQDFIKNITAN 187
            F   DL + ++K R+ I      ++  L       N +E+T      + F+K + AN
Sbjct: 138 SFNYEDLADPKYKGRVCIRSGKHPYNATLFGAMIAHNGVEET------EAFLKGVKAN 189


>gi|56460167|ref|YP_155448.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           loihiensis L2TR]
 gi|56179177|gb|AAV81899.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           loihiensis L2TR]
          Length = 341

 Score = 35.4 bits (80), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 85/185 (45%), Gaps = 19/185 (10%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPI 68
           L  FT A +  N      +Y+ + ++++ P++  F E TG++++ +   +     +    
Sbjct: 18  LVSFTSAAAEVN------IYSARKEALIKPVLEKFTEETGIEVNLLTGKADALLARLNSE 71

Query: 69  TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDTQV 123
            + +P D+ +T D  +L  A+  D    + +  I  NS V    ++ +     +S   + 
Sbjct: 72  GKNTPADLFLTVDAGALHRAVQADAFQAVSSDEI--NSAVPSHFRSTDNLWFGLSLRARP 129

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIK 182
           + YS +R+   +L +S   L + +W  R+ I + NN+    L+  + +       +++ +
Sbjct: 130 IFYSPERVNPDEL-ESYLSLADDKWSDRICIRSSNNLYNQSLVAALIEHHGAEKTEEWAE 188

Query: 183 NITAN 187
           +  AN
Sbjct: 189 DFVAN 193


>gi|330972176|gb|EGH72242.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 333

 Score = 35.0 bits (79), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
           ST      + +Y+ +   ++ P+  ++   TGVKI  I   + +  P+ Q        + 
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFI---TDKEAPLMQRIKAEGENAT 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L    + +I+ N     ++ +     +S   + +AYST R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSSHGWTGLSLRARTIAYSTDR 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K A+L  S ++ L +  W+ RL +      +++     L+ T     ++ +++ ++ N+
Sbjct: 135 VKPAEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|218462037|ref|ZP_03502128.1| ABC transporter, substrate binding protein (iron) [Rhizobium etli
           Kim 5]
          Length = 340

 Score = 35.0 bits (79), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 26/168 (15%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY- 59
           M  R+I T +LL      +       + + LYT +  +++ P++ +F + TG K++ I+ 
Sbjct: 1   MNSRSILTSMLLAASALMSPGIAAAAE-INLYTTREPALIAPLLEAFTKSTGTKVNTIFL 59

Query: 60  TSSIQRPPITQG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMR- 116
              +      +G  SP D+++  D  +L    DL+ K     ++  S VLK+   + +R 
Sbjct: 60  KDGLAERVAFEGASSPADILMAVDAGNLV---DLVDKGVTQPVE--SAVLKSAIPEQLRD 114

Query: 117 -------ISFDTQVLAYSTKRIKIADLPKSVF---DLTNAQWKKRLSI 154
                  +S   +VL Y+ K     DL  S F   +L + +WK ++ I
Sbjct: 115 AKGNWFALSMRARVL-YAAK-----DLDISTFNYEELADPKWKGKICI 156


>gi|317133199|ref|YP_004092513.1| von Willebrand factor type A [Ethanoligenens harbinense YUAN-3]
 gi|315471178|gb|ADU27782.1| von Willebrand factor type A [Ethanoligenens harbinense YUAN-3]
          Length = 535

 Score = 35.0 bits (79), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 10  LLLLCGFTEAFS-TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ-RPP 67
           +LL  GF+   S ++N    LT+ +      + PII  F ++TG+K++ +Y  S+     
Sbjct: 20  VLLAVGFSGCGSASQNAAVSLTVLSASENKEIAPIITQFTKQTGIKVNMVYKGSVDIMQT 79

Query: 68  ITQGS-PVDVIITKDETSLALNEDLLHKL 95
           + QG+ P D +   +   + L  D  HK+
Sbjct: 80  LQQGNIPYDAVWPANSMWINLG-DKAHKV 107


>gi|307152612|ref|YP_003887996.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
 gi|306982840|gb|ADN14721.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
          Length = 347

 Score = 35.0 bits (79), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 79/180 (43%), Gaps = 29/180 (16%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKD 81
           T+ + LY+ ++ +    +  +F ++TG+K++ I   +   I+R     + SP D++IT D
Sbjct: 34  TREVNLYSSRHYNTDRRLYDNFTKQTGIKVNLIEAEADPLIERIKSEGRNSPADILITVD 93

Query: 82  ETSL----------ALNEDLL-HKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
              L           +N  +L  K+PA+        L+         S   +V+ Y+  R
Sbjct: 94  AARLWRAYQAGLFTPVNSKILQQKIPAN--------LREPKGHWFAFSERLRVIMYNKNR 145

Query: 131 IKIADLPKSVFDLTNAQWKK----RLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNIT 185
           +K + L  S  DL N +WK     R S +  N SF   L+ T  +   +   + F+ N  
Sbjct: 146 VKPSQL-SSYDDLANPKWKGKVVSRSSSSTYNQSFVAWLIATRGEAAAEKWCRGFVANFA 204


>gi|261345718|ref|ZP_05973362.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Providencia rustigianii DSM 4541]
 gi|282566206|gb|EFB71741.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Providencia rustigianii DSM 4541]
          Length = 348

 Score = 35.0 bits (79), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 79/164 (48%), Gaps = 30/164 (18%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSS 62
           T+ + L++ C    A + ++    LTLYT +   ++ P++ +F + T + ++ +Y     
Sbjct: 16  TLASSLIVTCALP-AMAKDS----LTLYTTREPGLIQPLLDAFTKETAIDVNTVYIKDGM 70

Query: 63  IQRPPI-TQGSPVDVIITKDETSL-----------ALNEDLLHKLPAHLIKKNSFVLKNE 110
           ++R     + SP D+++T D  +L             +E L   +PA         L+++
Sbjct: 71  LERVKAEGKNSPADLLMTVDAGNLIDLVDAGVTQPVQSEVLTEVIPAS--------LRDK 122

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
           + +   +S   +VL Y+ K + ++ +  +  +L + QWK ++ I
Sbjct: 123 DNQWFGLSMRARVL-YAEKSMPLSSI--TYENLADPQWKGKICI 163


>gi|225388880|ref|ZP_03758604.1| hypothetical protein CLOSTASPAR_02620 [Clostridium asparagiforme
           DSM 15981]
 gi|225045053|gb|EEG55299.1| hypothetical protein CLOSTASPAR_02620 [Clostridium asparagiforme
           DSM 15981]
          Length = 347

 Score = 35.0 bits (79), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 78/202 (38%), Gaps = 32/202 (15%)

Query: 11  LLLCGFTEAFSTENTT------KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI- 63
           L L G   A  T+ +       K LT+YT   + V  PII  FEERTG+ +      SI 
Sbjct: 23  LCLSGCIRAEQTDYSAFAPAEDKRLTIYTSNLEEVYTPIIREFEERTGIWVQVENGGSIA 82

Query: 64  ---QRPPITQGSPVDVIITKDETSL--------ALNEDLLHKLPAHLIKKNSFVLKNENK 112
              Q    ++    DVI+     SL                 LP   ++ N         
Sbjct: 83  LLKQIAEESENPRCDVILGGSVESLYSFRNYFSPYKSAEAESLPPEYVQTNGL------- 135

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA--PNNISFHRLLNTMEQ 170
                S    VL Y+ K ++  + P     L +  WK +++ A    + S +  L+TM Q
Sbjct: 136 -WTPFSIPPVVLIYNPKLVR-TNPPTGWDSLLDPAWKGKIAFADPETSGSSYTALSTMVQ 193

Query: 171 ---TPNKTVVQDFIKNITANEI 189
                ++ +++ F +N+    I
Sbjct: 194 ILPGRDEELIRRFYENLEGRTI 215


>gi|299137934|ref|ZP_07031114.1| DNA-directed RNA polymerase, beta subunit [Acidobacterium sp.
            MP5ACTX8]
 gi|298599864|gb|EFI56022.1| DNA-directed RNA polymerase, beta subunit [Acidobacterium sp.
            MP5ACTX8]
          Length = 1498

 Score = 35.0 bits (79), Expect = 5.4,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 75/157 (47%), Gaps = 16/157 (10%)

Query: 52   GVKISPIYTSSIQRPPITQGSPVDVII------TKDETSLALNEDLLHKLPAHLIKKNSF 105
            G K   +  +S+  PP  +G+ VDV I       KD+ +L + ++++ KL  +L  +   
Sbjct: 1026 GEKAGDVRDASLTCPPGIEGTVVDVRIFSRKGQEKDQRALQIEQEMVEKLERNLADEIRI 1085

Query: 106  VLKNENKKLMRISFDTQVLA------YSTKRIKIAD-LPKSVFDLTNAQWKKRLSIAPNN 158
            +     K+L  I    +VLA       + K +   D L + + +L + +  KR+  A  +
Sbjct: 1086 LTDERLKRLEGILGSKEVLADLHDERTNKKLLSKGDILTRDIIELISTRNLKRIRYADKD 1145

Query: 159  ISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR 195
               +  ++ +E+  ++ +  D ++ IT NE + K ++
Sbjct: 1146 PRVNEQIDEIEEMTSRQI--DVLRKIT-NEKIGKMQK 1179


>gi|159044567|ref|YP_001533361.1| putative-binding protein component of ABC iron transporter
           [Dinoroseobacter shibae DFL 12]
 gi|157912327|gb|ABV93760.1| putative binding protein component of ABC iron transporter
           [Dinoroseobacter shibae DFL 12]
          Length = 342

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 83/189 (43%), Gaps = 14/189 (7%)

Query: 11  LLLCGFTEAFSTENTTKY----LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---I 63
           L L G T A +   +  Y    L LY+ ++      +   FEE TG+ ++ I  ++   I
Sbjct: 7   LPLAGLTAAATLLGSVAYAAGELNLYSSRHYDTDERLYSDFEEATGITVNRIEGNADELI 66

Query: 64  QRPPITQG-SPVDVIITKDETSLALNED--LLHKLPAHLIKKN-SFVLKNENKKLMRISF 119
            R       SP DV +T D   LA  +D  LL  + + +++      L++++ +    S 
Sbjct: 67  ARMEAEGANSPADVFLTVDTVRLARAKDLGLLQSVDSPILEGRIPAYLQDDDNQWFGFSQ 126

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             ++L Y   +  + + P +  DL   +++  + I +  N+    ++  + +   +  V 
Sbjct: 127 RARILFY--DKTDVENPPATYQDLAKPEYEGMVCIRSSTNVYTQNIVAALIEHLGEEAVT 184

Query: 179 DFIKNITAN 187
           D+ K +  N
Sbjct: 185 DWAKAVVGN 193


>gi|118340598|gb|ABK80648.1| putative DNA polymerase I [uncultured marine Nitrospinaceae
           bacterium]
          Length = 894

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 100 IKKNSFVLKNENKKLMRISFDTQVLAY----STKRIKIADLPKSVFDLTNAQWKKRLSIA 155
           IK +  VLK+E   L+ ++FDT + +Y    S +R  + D+ +     T  ++K+ +  A
Sbjct: 390 IKYDLIVLKSEGVNLVGVAFDTMLASYILNPSGRRHNMNDMARDYLGYTTTKYKEVVGTA 449

Query: 156 PNNISFHRL 164
              I F ++
Sbjct: 450 SKEIGFDKV 458


>gi|254252759|ref|ZP_04946077.1| ABC-type Fe3+ transport system periplasmic component [Burkholderia
           dolosa AUO158]
 gi|124895368|gb|EAY69248.1| ABC-type Fe3+ transport system periplasmic component [Burkholderia
           dolosa AUO158]
          Length = 347

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 77/172 (44%), Gaps = 22/172 (12%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-SPVDVIITKDETSL 85
           ++LYT +   ++ P+I +F +++GVK++ ++     ++R       SP DV++T D  +L
Sbjct: 32  VSLYTTREPKLIQPLIDAFTKQSGVKVNTVFVKDGLLERVKAEGAQSPADVLMTVDIGNL 91

Query: 86  ALNEDLLHKLPAHLIKKNSFV------LKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       ++ N         L+        +S   +VL Y  K +K+      
Sbjct: 92  L---DLVDGGLTQPVRSNVLDEAIPANLRGTQGDWYALSLRDRVL-YVEKDLKV-----D 142

Query: 140 VF---DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            F   DL + +WK ++ I      ++  L+  M     +   + +++ + AN
Sbjct: 143 AFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGEAATEKWLRGVKAN 194


>gi|221104889|ref|XP_002170216.1| PREDICTED: similar to very large inducible GTPase-1, partial [Hydra
           magnipapillata]
          Length = 1745

 Score = 35.0 bits (79), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 7/109 (6%)

Query: 89  EDLLHKLPAHLIKKNSFVLKNENKKLM------RISFDTQVLAYSTKRIKIADLPKSVFD 142
           E+++ K+  H++KK  FVLK EN+KL+       I+ +   +    K I IADL +S+F 
Sbjct: 355 EEIIAKVK-HMLKKMYFVLKQENEKLVTFNEVNGITINLLKMLKLHKNISIADLFESIFC 413

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILT 191
                 + +    P++ SF ++L+ +    +K   ++  + +  N IL+
Sbjct: 414 QYGYNSETKSFERPDSDSFLKMLDNINFALDKLKDENMFEEVLENRILS 462


>gi|261822236|ref|YP_003260342.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
 gi|261606249|gb|ACX88735.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
          Length = 348

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVDVIITKDETSL 85
           LTLYT +   ++ P++ +F + T V ++ ++     ++R     Q SP D+++T D  +L
Sbjct: 35  LTLYTTREPGLIQPLLDAFTKETSVNVNTVFIKDGMLERVKAEGQNSPADLLMTVDAGNL 94

Query: 86  ALNEDLLHKLPAHLIKKNSF------VLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
               DL+       I+ ++        L++++ +   +S  ++VL Y+ K + +  +  +
Sbjct: 95  I---DLVEAGVTQPIQSSTLTDVIPAALRDKDNQWFGLSMRSRVL-YAEKSLPLTSI--T 148

Query: 140 VFDLTNAQWKKRLSI 154
             +L + +WK ++ I
Sbjct: 149 YENLADPKWKGKVCI 163


>gi|328949758|ref|YP_004367093.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450082|gb|AEB10983.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Marinithermus hydrothermalis DSM 14884]
          Length = 347

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 67/145 (46%), Gaps = 15/145 (10%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS----SIQRPPITQGSPV 74
           AF+TE     LT+ T  + S+   +I  F+E TG+++  I       ++ +  +++G+P+
Sbjct: 16  AFATE-----LTVLTHSSFSLDEALIQQFQEETGIQVRFIEGGDAGETLNKAILSKGAPI 70

Query: 75  -DVIITKDET--SLALNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTK 129
            DVI   D T  S AL   +L    +  I+  K+ F+L +     +   F    L Y   
Sbjct: 71  ADVIYGFDNTFLSRALEAGILEPYVSPEIRNLKSEFLL-DPTFHAIPTDFGYVALNYDKA 129

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSI 154
                 LP+   DLT  ++  RL +
Sbjct: 130 AFDALPLPQRFEDLTRPEYASRLVV 154


>gi|153011145|ref|YP_001372359.1| extracellular solute-binding protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563033|gb|ABS16530.1| extracellular solute-binding protein family 1 [Ochrobactrum
           anthropi ATCC 49188]
          Length = 338

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/141 (19%), Positives = 72/141 (51%), Gaps = 9/141 (6%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPITQG--SPVDV 76
           F+       + +YT +   ++ P++ SF+  TG+ ++ ++    +     ++G  SP D+
Sbjct: 17  FAGAAHADEVNIYTTREPGLIQPLLDSFKSSTGITVNTVFLKDGLAERVASEGANSPADI 76

Query: 77  IITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L   +++ L   + + ++K+     L++       +S   +V+ Y+ K +++
Sbjct: 77  LMTVDAGNLVDLVDKGLTQPVDSKVLKEAVPEQLRDAKDNWFALSMRARVV-YAAKDLEL 135

Query: 134 ADLPKSVFDLTNAQWKKRLSI 154
             +  +  DL++ +WK ++ I
Sbjct: 136 DKI--NYEDLSDPKWKGKVCI 154


>gi|330943302|gb|EGH45687.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 333

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 84/183 (45%), Gaps = 21/183 (11%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
           ST      + +Y+ +   ++ P+  ++   TGVKI  I   + +  P+ Q        + 
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFI---TDKEAPLMQRIKAEGENAT 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L    + +I+ N     ++       +S   + +AYST R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDR 134

Query: 131 IKIADLPKSVFD-LTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNI 184
           +K A+L  S ++ L +  W+ RL +      +++     L+ T     ++ +++ ++ N+
Sbjct: 135 VKPAEL--STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNL 192

Query: 185 TAN 187
           + +
Sbjct: 193 STD 195


>gi|237797926|ref|ZP_04586387.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331020777|gb|EGI00834.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 196

 Score = 35.0 bits (79), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 82/182 (45%), Gaps = 19/182 (10%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-------GSP 73
           ST      + +Y+ +   ++ P+  ++  +TGVKI  I   + +  P+ Q        + 
Sbjct: 18  STAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFI---TDKEAPLMQRIKAEGENAT 74

Query: 74  VDVIITKDETSLALNEDL--LHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            D+++T D  +L   E +  L    + +I  N     ++       +S   + +AYST R
Sbjct: 75  ADLLLTVDAGNLWQAEQMGILQPFTSPVIDANIPPQYRSSTHSWTGLSLRARTIAYSTDR 134

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHR-----LLNTMEQTPNKTVVQDFIKNIT 185
           +K A+L  +   L +  W+ RL +      +++     L+ T     ++ +++ ++ N++
Sbjct: 135 VKPAEL-TTYEALADKHWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNNLS 193

Query: 186 AN 187
            +
Sbjct: 194 TD 195


>gi|56698111|ref|YP_168483.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
 gi|56679848|gb|AAV96514.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
          Length = 349

 Score = 34.7 bits (78), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 82/172 (47%), Gaps = 20/172 (11%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG----SPVDVIITKDETS 84
           L LY+ ++      +   FEE TG++I+ I   + +     Q     SP DV++T D + 
Sbjct: 37  LNLYSSRHYDTDERLYTDFEEATGIRINRIEGKADELIARMQAEGANSPADVLLTVDTSR 96

Query: 85  LALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTK-------RIKIADL 136
           LA  ++      A L++  +S VL++     ++ S D Q   +S +       +  ++  
Sbjct: 97  LARAKE------AGLLQAIDSAVLEDRIPANLQDS-DNQWFGFSQRARLYFYDKAGVSAP 149

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIKNITAN 187
           P +  DL +  +K ++ I  +  ++++ LL  +     + V +D+ +++ AN
Sbjct: 150 PATYLDLADPAYKGQVCIRSSTNTYNQTLLAAIITHHGEDVARDWAESVVAN 201


>gi|322832369|ref|YP_004212396.1| extracellular solute-binding protein family 1 [Rahnella sp.
          Y9602]
 gi|321167570|gb|ADW73269.1| extracellular solute-binding protein family 1 [Rahnella sp.
          Y9602]
          Length = 345

 Score = 34.7 bits (78), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 29 LTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPI-TQGSPVDVIITKDETSL 85
          LTLYT +   ++ P++ S+ + +G+K++ +Y     ++R     Q SP D+++T D  +L
Sbjct: 32 LTLYTTREPGLIQPLLDSWTQSSGIKVNTVYIKDGMLERVKAEGQNSPADLLMTVDAGNL 91


>gi|289450048|ref|YP_003474637.1| extracellular solute-binding protein [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184595|gb|ADC91020.1| bacterial extracellular solute-binding protein [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
          Length = 368

 Score = 34.7 bits (78), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ---RPPITQGSPV-DVIITKDETS 84
           + +YT +++S+   +IH+FE  TG+K+  +   + +   R    + +P+ DV+   DET 
Sbjct: 59  VVVYTARSESLNNLVIHAFEASTGIKVETVVAGTGELQKRVESEKDNPLGDVLWAADETM 118

Query: 85  LALNEDLLHK 94
           L+   DL  K
Sbjct: 119 LSPYRDLFEK 128


>gi|28899265|ref|NP_798870.1| iron(III) ABC transporter periplasmic iron-compound-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|260879039|ref|ZP_05891394.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260895914|ref|ZP_05904410.1| iron(III) dicitrate ABC transporter, ATP-binding protein FecE
           [Vibrio parahaemolyticus Peru-466]
 gi|28807489|dbj|BAC60754.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085375|gb|EFO35070.1| iron(III) dicitrate ABC transporter, ATP-binding protein FecE
           [Vibrio parahaemolyticus Peru-466]
 gi|308089574|gb|EFO39269.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|328474198|gb|EGF45003.1| iron(III) ABC transporter periplasmic iron-compound-binding protein
           [Vibrio parahaemolyticus 10329]
          Length = 337

 Score = 34.7 bits (78), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 82/169 (48%), Gaps = 13/169 (7%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P+ + F + TG+K++  +        + Q    SP DV++T D + L
Sbjct: 25  VNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKEGLAEKLAQEGEYSPADVVLTTDISRL 84

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           A   N+ L+ K+ + +I++N     +++  +   ++  T+ +  S  R+       +  D
Sbjct: 85  AELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRTRSVYSSRDRVGKLGADFNYAD 144

Query: 143 LTNAQWKKRLSIA----PNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   ++K ++       P N+S   L+++M     +   +++++ + AN
Sbjct: 145 LAKPEYKGKICTRSGKHPYNVS---LVSSMIAHYGEAETKEWLEGVKAN 190


>gi|313675764|ref|YP_004053760.1| extracellular solute-binding protein family 1 [Marivirga tractuosa
           DSM 4126]
 gi|312942462|gb|ADR21652.1| extracellular solute-binding protein family 1 [Marivirga tractuosa
           DSM 4126]
          Length = 372

 Score = 34.7 bits (78), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           + +YT ++      +   FEE+TG+K++ +  ++   IQ+  +  + SP DV+IT D   
Sbjct: 59  VNVYTHRHYESDQQLFKDFEEKTGIKVNVVSANADELIQKMTLEGENSPADVLITVDAGR 118

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRI 131
           L  A   DLL  + +  +    S  L++ + +   ++   +V+ Y+ ++I
Sbjct: 119 LHRAKEADLLQSVESETLNNTISSNLRDVDNQWFGLTIRGRVIVYNPEKI 168


>gi|262395417|ref|YP_003287270.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           ModA [Vibrio sp. Ex25]
 gi|262339011|gb|ACY52805.1| molybdenum ABC transporter, periplasmic molybdenum-binding protein
           ModA [Vibrio sp. Ex25]
          Length = 251

 Score = 34.7 bits (78), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 43  IIHSFEERTGVKISPIY--TSSIQRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAH 98
           I  +FEE+  V I+P+Y  +SSI R  I  G+P D+ I+ +   +   +++D++ +    
Sbjct: 41  IAQNFEEKYDVSITPVYGGSSSIAR-QIINGAPADIFISANTKWMDYLVDKDVISRDNVT 99

Query: 99  LIKKNSFVL 107
            + +NS VL
Sbjct: 100 SLVRNSLVL 108


>gi|330814351|ref|YP_004358590.1| ferric iron ABC transporter, iron-binding protein [Candidatus
          Pelagibacter sp. IMCC9063]
 gi|327487446|gb|AEA81851.1| ferric iron ABC transporter, iron-binding protein [Candidatus
          Pelagibacter sp. IMCC9063]
          Length = 338

 Score = 34.7 bits (78), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 9/88 (10%)

Query: 3  KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
          K+ I+T L +L     +F+ E     + L+T ++ S  + +   F  +TG+K++ I    
Sbjct: 2  KKIIFTGLFVLSTICSSFAAE-----VNLFTSRHYSSDVELYKKFTNKTGIKVNVIKAKY 56

Query: 61 SSIQRPPITQG--SPVDVIITKDETSLA 86
            +++  +++G  S  DV+IT D  +L 
Sbjct: 57 KVLEKRLLSEGKSSKADVVITVDAGALG 84


>gi|153838407|ref|ZP_01991074.1| iron binding protein FbpA [Vibrio parahaemolyticus AQ3810]
 gi|149748214|gb|EDM59073.1| iron binding protein FbpA [Vibrio parahaemolyticus AQ3810]
          Length = 336

 Score = 34.7 bits (78), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 82/169 (48%), Gaps = 13/169 (7%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQG---SPVDVIITKDETSL 85
           + +Y+ +   ++ P+ + F + TG+K++  +        + Q    SP DV++T D + L
Sbjct: 24  VNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKEGLAEKLAQEGEYSPADVVLTTDISRL 83

Query: 86  A--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           A   N+ L+ K+ + +I++N     +++  +   ++  T+ +  S  R+       +  D
Sbjct: 84  AELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRTRSVYSSRDRVGKLGADFNYAD 143

Query: 143 LTNAQWKKRLSIA----PNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L   ++K ++       P N+S   L+++M     +   +++++ + AN
Sbjct: 144 LAKPEYKGKICTRSGKHPYNVS---LVSSMIAHYGEAETKEWLEGVKAN 189


>gi|167855400|ref|ZP_02478166.1| FbpA [Haemophilus parasuis 29755]
 gi|167853466|gb|EDS24714.1| FbpA [Haemophilus parasuis 29755]
          Length = 341

 Score = 34.7 bits (78), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 80/167 (47%), Gaps = 9/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPVDVIITKDETS 84
           + +Y+ +   ++ P++  FE++TG+K++ I+     ++R    +G  SP DV++T D + 
Sbjct: 26  VNVYSYRQPYLIEPMLKDFEKQTGIKVNVIFADKGLVERVQ-KEGELSPADVLLTVDISR 84

Query: 85  LA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           +   +   L  K+ +  ++KN     ++ N +   ++   +V+  S  R+          
Sbjct: 85  VMQIVKAGLAQKVDSKTLEKNIPAQFRDSNGEWFGLTKRARVIYTSKDRVGALPAGFDYL 144

Query: 142 DLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
           DL   ++K ++ +     +++  L   M +   +   + F++ + AN
Sbjct: 145 DLAKPEYKGKVCVRSGKNAYNVSLFAAMIEHYGEEKTKAFLEGLKAN 191


>gi|315123777|ref|YP_004065781.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|315017499|gb|ADT65592.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 134

 Score = 34.7 bits (78), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPI-TQGSPVDVIITKDETS 84
           L +Y+ ++ +    II  FEE+TG+K++     +   I+R  +    SP D+ IT D ++
Sbjct: 20  LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSNSPADIFITADISN 79

Query: 85  L--ALNEDLLHK---------LPAHLIKKN 103
           L  A N  LL           +PAHL  K+
Sbjct: 80  LTEAKNLGLLSPVSSKYLEEFIPAHLRDKD 109


>gi|219871315|ref|YP_002475690.1| periplasmic iron-binding protein [Haemophilus parasuis SH0165]
 gi|219691519|gb|ACL32742.1| periplasmic iron-binding protein [Haemophilus parasuis SH0165]
          Length = 341

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 31/168 (18%), Positives = 79/168 (47%), Gaps = 11/168 (6%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-----IQRPPITQGSPVDVIITKDET 83
           + +Y+ +   ++ P++  FE++TG+K++ I+        +Q+    + SP DV++T D +
Sbjct: 26  VNVYSYRQPYLIEPMLKDFEKQTGIKVNVIFADKGLVERVQKE--GELSPADVLLTVDIS 83

Query: 84  SLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +   +   L  K+ +  ++KN     ++ N +   ++   +V+  S  R+         
Sbjct: 84  RVMQIVKAGLAQKVDSKTLEKNIPAQFRDSNGEWFGLTKRARVIYTSKDRVGALPAGFDY 143

Query: 141 FDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            DL   ++K ++ +     +++  L   M +   +   + F++ + AN
Sbjct: 144 LDLAKPEYKGKVCVRSGKNAYNVSLFAAMIEHYGEEKTKAFLEGLKAN 191


>gi|254466777|ref|ZP_05080188.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
 gi|206687685|gb|EDZ48167.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
          Length = 338

 Score = 34.3 bits (77), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 82/167 (49%), Gaps = 10/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR-PPITQGSPVDVIITKDETS 84
           L +Y+ ++      +   FEE TG+ I+ I  ++   I R     + SP D++IT D + 
Sbjct: 26  LNIYSSRHYDTDEQLYSEFEEATGITINRIEGNADELIARMTAEGENSPADILITVDTSR 85

Query: 85  L--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A +  +L  + + +++      L++E+ +    S   +++ Y+  +  +A+ P +  
Sbjct: 86  LTRAKDAGVLQSIESDVLEARVPGYLQDEDNQWFGFSQRARIIFYN--KDAVANPPLTYL 143

Query: 142 DLTNAQWKKRLSIAPNNISFHR-LLNTMEQTPNKTVVQDFIKNITAN 187
           DL +  +K ++ I  +  ++++ LL ++         +++ + + AN
Sbjct: 144 DLADPAYKGKVCIRSSKNTYNQTLLASIVTHHGADAARNWAEGVVAN 190


>gi|153952205|ref|YP_001397430.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939651|gb|ABS44392.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 334

 Score = 34.3 bits (77), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 75/154 (48%), Gaps = 14/154 (9%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQR 65
           + + L  F+   ++E     L +Y+ ++      I+  FEE+TG+K++     +   I+R
Sbjct: 5   FFMFLTAFSFLGASE-----LNIYSARHYDADFEIMKKFEEKTGIKVNHTQAKASELIKR 59

Query: 66  PPI-TQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFV---LKNENKKLMRISFDT 121
             +    SP D+ +T D ++L   ++L    P        F+   LK+++K+    +   
Sbjct: 60  LSLEGSNSPADIFMTGDISNLTEVKNLGLLSPVSSKYLEEFIPAHLKDKDKEWFAFAKRA 119

Query: 122 QVLAYS-TKRIKIADLPKSVFDLTNAQWKKRLSI 154
           +++AY+    I I+ + K+  DL   ++K  +++
Sbjct: 120 RIIAYNKNANIDISKM-KNYEDLAKPEFKGEIAM 152


>gi|19115666|ref|NP_594754.1| septin Spn1 [Schizosaccharomyces pombe 972h-]
 gi|12643553|sp|O36023|SPN1_SCHPO RecName: Full=Septin homolog spn1
 gi|6977953|emb|CAB11714.2| septin Spn1 [Schizosaccharomyces pombe]
 gi|15487672|gb|AAB53692.2| spn1+ [Schizosaccharomyces pombe]
          Length = 469

 Score = 34.3 bits (77), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 79  TKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
           T D  S+A N D++ ++P  +I  N+FV+ NE K++    +   V+    +  + +D PK
Sbjct: 279 TDDPESVAENADIMSRIPFAIIASNTFVVNNEGKRVRGRRYPWGVVEVDNE--EHSDFPK 336


>gi|125974097|ref|YP_001038007.1| extracellular solute-binding protein [Clostridium thermocellum ATCC
           27405]
 gi|256004427|ref|ZP_05429407.1| extracellular solute-binding protein family 1 [Clostridium
           thermocellum DSM 2360]
 gi|281418242|ref|ZP_06249262.1| extracellular solute-binding protein family 1 [Clostridium
           thermocellum JW20]
 gi|125714322|gb|ABN52814.1| extracellular solute-binding protein, family 1 [Clostridium
           thermocellum ATCC 27405]
 gi|255991568|gb|EEU01670.1| extracellular solute-binding protein family 1 [Clostridium
           thermocellum DSM 2360]
 gi|281409644|gb|EFB39902.1| extracellular solute-binding protein family 1 [Clostridium
           thermocellum JW20]
 gi|316941342|gb|ADU75376.1| extracellular solute-binding protein family 1 [Clostridium
           thermocellum DSM 1313]
          Length = 368

 Score = 34.3 bits (77), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPPITQGSPV-DVIITKDETS 84
           L +YT +++ +   +I  FE+ TG+K+  +   +   ++R    + +P+ D++   D T 
Sbjct: 58  LVVYTARSEELNKAVISEFEKETGIKVELVTAGTGELLKRVESEKDNPLGDILWAADRTM 117

Query: 85  LALNEDLL 92
           LA +EDL 
Sbjct: 118 LAASEDLF 125


Searching..................................................done


Results from round 2




>gi|307130565|ref|YP_003882581.1| Ferric iron ABC transporter iron-binding protein [Dickeya dadantii
           3937]
 gi|306528094|gb|ADM98024.1| Ferric iron ABC transporter, iron-binding protein [Dickeya dadantii
           3937]
          Length = 338

 Score =  254 bits (649), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 99/200 (49%), Gaps = 11/200 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F  T+    L++     +F  +   + L +Y  Q+++++   +  F + TG+K++    
Sbjct: 8   LFPATLLASSLMM---GFSFGAQAEDEGLVIYNAQHENLVKSWVDGFTQDTGIKVTLRNG 64

Query: 61  --SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
             S +    + +G  SP DV +T++  S+ L  N +L   L A  +++ +   +  + + 
Sbjct: 65  GDSELGNQLVQEGNSSPADVFLTENSPSMVLVDNANLFAPLDAGTLEQVAPQYRPSHGRW 124

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           + I+  + V  Y+ +++  A LPKS+ DL   +WK R + +P+   F  +++ M +   +
Sbjct: 125 IGIAARSTVFVYNPEKLTEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGE 184

Query: 175 TVVQDFIKNITANEILTKYK 194
               +++K +  N   T YK
Sbjct: 185 KATLEWLKAMKTN--FTAYK 202


>gi|238791996|ref|ZP_04635632.1| Iron(III)-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
 gi|238728627|gb|EEQ20145.1| Iron(III)-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
          Length = 373

 Score =  253 bits (647), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 92/194 (47%), Gaps = 10/194 (5%)

Query: 9   YLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQ 64
             LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S + 
Sbjct: 46  VALLASSMMLAFSVNAASNDEGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELG 105

Query: 65  RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
              + +G  SP DV +T++  ++ L  N  L   L      + +   + E+ +   I+  
Sbjct: 106 NQLVQEGNSSPADVFLTENSPAMVLVDNAKLFSPLDTATQAQVAKEYRPEHGRWTGIAAR 165

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
           + V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +    ++
Sbjct: 166 STVFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEW 225

Query: 181 IKNITANEILTKYK 194
           +K +  N   T YK
Sbjct: 226 LKAMKTN--FTAYK 237


>gi|311280106|ref|YP_003942337.1| extracellular solute-binding protein family 1 [Enterobacter cloacae
           SCF1]
 gi|308749301|gb|ADO49053.1| extracellular solute-binding protein family 1 [Enterobacter cloacae
           SCF1]
          Length = 338

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 44/202 (21%), Positives = 97/202 (48%), Gaps = 11/202 (5%)

Query: 2   FKRTIYTYLLLLCG---FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           F+ + Y  + L+             ++++ + +Y  Q+++++   +  F + TG+K++  
Sbjct: 3   FRLSAYCSIALVTSSLFLAPQALAADSSEGIVVYNAQHENLVKSWVDGFTKETGIKVTLR 62

Query: 59  YT--SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
               S +    + +GS  P DV +T++  S+ L  N  L   L    +K+     + E+ 
Sbjct: 63  NGGDSELGNQLVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDEATLKQVPAEYRPEHG 122

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
           + + I+  + V  Y+ +++  A LPKS+ DL   +WK R + +P+   F  +++ M +  
Sbjct: 123 RWIGIAARSTVFVYNPEKLSEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELK 182

Query: 173 NKTVVQDFIKNITANEILTKYK 194
            +    +++K +  N   T YK
Sbjct: 183 GEKATLEWLKAMKTN--FTAYK 202


>gi|242239853|ref|YP_002988034.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech703]
 gi|242131910|gb|ACS86212.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech703]
          Length = 338

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 93/199 (46%), Gaps = 10/199 (5%)

Query: 4   RTIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
            ++++  LL       FS   +     + +Y  Q+++++     +F + TG+K++     
Sbjct: 6   ASLFSVTLLASSLMLGFSCNAQAEADGIVVYNAQHENLVKSWADAFTQETGIKVTLRNGG 65

Query: 61  -SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
            S +    + +GS  P DV +T++  ++ L  N  L   + A  +++     +  + + +
Sbjct: 66  DSELGNQLVQEGSATPADVFLTENSPAMVLVDNAHLFAPVDAETLQQVEPQYRPSHGRWI 125

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            I+  + V  Y+ ++I  A LPKS+ DL   +WK R + +P+   F  +++ M     + 
Sbjct: 126 GIAARSTVFVYNPEKISEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQ 185

Query: 176 VVQDFIKNITANEILTKYK 194
               ++K +  N   T YK
Sbjct: 186 ETLAWLKAMKTN--FTAYK 202


>gi|238764183|ref|ZP_04625136.1| Iron(III)-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
 gi|238697596|gb|EEP90360.1| Iron(III)-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
          Length = 338

 Score =  251 bits (641), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 95/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS       + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPAALLASSLMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +G  SP DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 67  SELGNQLVQEGGASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  ++LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISESELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K + AN   T YK
Sbjct: 187 TLEWLKAMKAN--ATAYK 202


>gi|86359635|ref|YP_471527.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
 gi|86283737|gb|ABC92800.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
          Length = 340

 Score =  251 bits (641), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 8/199 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F R +     LL     A S     + L +Y  Q++S+    I +F + TG+K++     
Sbjct: 8   FSRVLTLAASLLSATALAGSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGG 67

Query: 62  SIQ--RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
            +Q     I +G  SP DV +T++  ++ L     L   +    + +     +  +    
Sbjct: 68  DMQFANQIIQEGDASPADVFLTENSPAMTLVDGAGLFAPVEKETLDQVPEQYRPADGMWT 127

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            I+  T V AY   ++    LPKS+ DL +  WK R   AP    F  ++  + Q   + 
Sbjct: 128 GIAARTTVFAYDKTKLSEDKLPKSLLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGED 187

Query: 176 VVQDFIKNITANEILTKYK 194
             + ++K +  N   T YK
Sbjct: 188 ATKAWLKGLKDN--ATPYK 204


>gi|251790119|ref|YP_003004840.1| extracellular solute-binding protein family 1 [Dickeya zeae
           Ech1591]
 gi|247538740|gb|ACT07361.1| extracellular solute-binding protein family 1 [Dickeya zeae
           Ech1591]
          Length = 338

 Score =  251 bits (641), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 98/200 (49%), Gaps = 11/200 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F  T+    L++     +F  +     + +Y  Q+++++   +  F + TG+K++    
Sbjct: 8   LFPATLLASSLMM---GFSFGAQAEESGIVIYNAQHENLVKSWVDGFTQDTGIKVTLRNG 64

Query: 61  --SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
             S +    + +G  SP DV +T++  S+ L  N +L   L A  + +     +  + + 
Sbjct: 65  GDSELGNQLVQEGNASPADVFLTENSPSMVLVDNANLFAPLDAGTLAQVESQYRPSHGRW 124

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           + I+  + V  Y+ +++  A LPKS+ DL N +WK R + +P+   F  +++ M +   +
Sbjct: 125 VGIAARSTVFVYNPEKLTEAQLPKSLMDLANPEWKGRWAASPSGADFQAIVSAMLELKGE 184

Query: 175 TVVQDFIKNITANEILTKYK 194
               +++K + AN   T YK
Sbjct: 185 KATLEWLKAMKAN--FTAYK 202


>gi|332162496|ref|YP_004299073.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666726|gb|ADZ43370.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863744|emb|CBX73843.1| Fe(3+)-binding periplasmic protein [Yersinia enterocolitica W22703]
          Length = 338

 Score =  250 bits (640), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 94/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS       + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKTN--FTAYK 202


>gi|91065105|gb|ABE03937.1| permease [Theonella swinhoei bacterial symbiont clone pSW1H8]
          Length = 332

 Score =  250 bits (639), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 95/192 (49%), Gaps = 11/192 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           R +   L+   G   A +     + LT+Y+ +N++ + P+I +FE+ TG+ +   Y  + 
Sbjct: 7   RALLFVLITTLGLGSAIA-----QTLTVYSGRNEAFVGPVIEAFEQTTGIDVEVRYGGTA 61

Query: 64  QRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
                 + +G  SP DV + +D  +L     E L  +LP  ++ +     ++     + +
Sbjct: 62  ALAAVILEEGNLSPADVFLAQDAGALGALSREGLFQRLPDSILSQVDARFRSPEGLWVGV 121

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +   +VL YST+ +   +LP SVF+LT  +W+ R+  AP N SF   +  M     +   
Sbjct: 122 TGRARVLVYSTENVAEEELPMSVFELTGPEWQGRVGWAPTNGSFQAFVTAMRVVVGEERT 181

Query: 178 QDFIKNITANEI 189
           +++++ + AN +
Sbjct: 182 REWLQGMIANGV 193


>gi|271500997|ref|YP_003334022.1| family 1 extracellular solute-binding protein [Dickeya dadantii
           Ech586]
 gi|270344552|gb|ACZ77317.1| extracellular solute-binding protein family 1 [Dickeya dadantii
           Ech586]
          Length = 338

 Score =  250 bits (639), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 96/200 (48%), Gaps = 11/200 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F  T+    L++     +F  +     + +Y  Q+++++   +  F + TG+K++    
Sbjct: 8   LFPATLLASSLMM---GLSFGVQAEEAGIVIYNAQHENLVKSWVDGFTQDTGIKVTLRNG 64

Query: 61  --SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
             S +    + +GS  P DV +T++  S+ L  N +L   L A  + +     +  + + 
Sbjct: 65  GDSELGNQLVQEGSASPADVFLTENSPSMVLVDNANLFAPLDADTLAQVEPQYRPSHGRW 124

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           + I+  + V  Y+ +++  A LPKS+ DL   +WK R + +P+   F  +++ M +   +
Sbjct: 125 IGIAARSTVFVYNPEKLTEAQLPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGE 184

Query: 175 TVVQDFIKNITANEILTKYK 194
               D++K +  N   T YK
Sbjct: 185 KATLDWLKAMKTN--FTAYK 202


>gi|318606576|emb|CBY28074.1| ferric iron ABC transporter, iron-binding protein [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 338

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 93/198 (46%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS       + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFSANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I   +LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISETELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKTN--FTAYK 202


>gi|50122060|ref|YP_051227.1| iron(III)-binding periplasmic protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49612586|emb|CAG76036.1| iron(III)-binding periplasmic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 338

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 94/197 (47%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + +LL  G T + S       + + +Y  Q+++++   +  F + TG+K++    S  
Sbjct: 8   LSSAVLLASGLTLSASANAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRSGSDT 67

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  S+ L  N DL   L    + + +   +  + + + I
Sbjct: 68  ELGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKATLAQVAPDYRPSHGRWVGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +   A LPKS+ DL   +WK R + +P+   F  +++   +   +   
Sbjct: 128 AARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLEQKGEKAT 187

Query: 178 QDFIKNITANEILTKYK 194
           Q+++K +  N   T YK
Sbjct: 188 QEWLKGMKEN--FTAYK 202


>gi|238798707|ref|ZP_04642180.1| Iron(III)-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
 gi|238717464|gb|EEQ09307.1| Iron(III)-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
          Length = 343

 Score =  248 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 88/187 (47%), Gaps = 8/187 (4%)

Query: 14  CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQG 71
                +    +  + + +Y  Q+++++   +  F + TG+K++      S +    + +G
Sbjct: 23  MALAFSAHAASNDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRNGGDSELGNQLVQEG 82

Query: 72  S--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
           S  P DV +T++  ++ L  N  L   L A    + +   + ++ +   I+  + V  Y+
Sbjct: 83  SASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPDHGRWTGIAARSTVFVYN 142

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            ++I  A LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N
Sbjct: 143 PEKISEAQLPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN 202

Query: 188 EILTKYK 194
              T YK
Sbjct: 203 --FTAYK 207


>gi|296103514|ref|YP_003613660.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057973|gb|ADF62711.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 338

 Score =  248 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 86/179 (48%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQGS--PVDVI 77
             +  + + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV 
Sbjct: 26  AADNNEGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDSELGNQLVQEGSASPADVF 85

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           +T++  S+ L  N  L   L A  +K+     +  + + + I+  + V  Y+ +++    
Sbjct: 86  LTENSPSMVLVDNAKLFASLDAETLKQVPAEYRPAHGRWIGIAARSTVFVYNPEKLSEQQ 145

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           LPKS+ DL   +WK R + +P+   F  +++ M     +    +++K + AN     YK
Sbjct: 146 LPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLEWLKAMKAN--FVAYK 202


>gi|209551354|ref|YP_002283271.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537110|gb|ACI57045.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 340

 Score =  248 bits (634), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 84/199 (42%), Gaps = 8/199 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F + +      L     A S     + L +Y  Q++S+    I +F + TG+K++     
Sbjct: 8   FSQALALAASFLSATALAGSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGG 67

Query: 62  SIQ--RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
            +Q     I +G  SP DV +T++  ++ L     L   +    + +     +  +    
Sbjct: 68  DMQFANQIIQEGDASPADVFLTENSPAMTLVDGAGLFAPIEKDTLDQVPDQYRPSDGMWT 127

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            I+  T V AY   ++    LPKS+ DL +  WK R   AP    F  ++ ++ Q   + 
Sbjct: 128 GIAARTTVFAYDKTKLTEDKLPKSMLDLADPAWKGRWGAAPAGADFQAIVASLLQLKGED 187

Query: 176 VVQDFIKNITANEILTKYK 194
             + ++K +  N   T YK
Sbjct: 188 ATKAWLKGLKDN--ATPYK 204


>gi|123441578|ref|YP_001005564.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088539|emb|CAL11333.1| iron(III)-binding periplasmic protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 338

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 95/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAF--STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AF  +  +  + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFYANAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISEAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKTN--FTAYK 202


>gi|261820665|ref|YP_003258771.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
 gi|261604678|gb|ACX87164.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
          Length = 338

 Score =  248 bits (633), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 92/197 (46%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + +LL  G T   S       + + +Y  Q+++++   +  F + TG+K++    S  
Sbjct: 8   LSSAVLLASGLTLGTSANAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRSGSDT 67

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  S+ L  N DL   L    + + +   +  + + + I
Sbjct: 68  ELGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKATLAQVAPDYRPSHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +   A LP S+ DL   +WK R + +P+   F  +++   +   +   
Sbjct: 128 AARSTVFVYNPTKFTDAQLPTSLADLAKPEWKGRWAASPSGADFQAIVSAYLELKGEKAT 187

Query: 178 QDFIKNITANEILTKYK 194
           Q+++K +  N   T YK
Sbjct: 188 QEWLKGMKEN--FTAYK 202


>gi|157370774|ref|YP_001478763.1| extracellular solute-binding protein [Serratia proteamaculans 568]
 gi|157322538|gb|ABV41635.1| extracellular solute-binding protein family 1 [Serratia
           proteamaculans 568]
          Length = 338

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 44/193 (22%), Positives = 92/193 (47%), Gaps = 10/193 (5%)

Query: 10  LLLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQR 65
            LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      S +  
Sbjct: 12  ALLASSMMLAFSANAASQDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGN 71

Query: 66  PPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
             + +GS  P DV +T++  S+ L  N  L   L A  + +     + ++ + + I+  +
Sbjct: 72  QLVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDAATLAQVEPQYRPQHGRWIGIAARS 131

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
            V  Y+  ++  A LPKS+ DL   +WK R + +P+   F  +++ + +   +    +++
Sbjct: 132 TVFVYNPAKLTEAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLEWL 191

Query: 182 KNITANEILTKYK 194
           K +  N   T YK
Sbjct: 192 KAMKTN--FTAYK 202


>gi|238759507|ref|ZP_04620670.1| Iron(III)-binding periplasmic protein [Yersinia aldovae ATCC 35236]
 gi|238702282|gb|EEP94836.1| Iron(III)-binding periplasmic protein [Yersinia aldovae ATCC 35236]
          Length = 338

 Score =  247 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 95/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS    +  + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLAPIALLASSVLLAFSVNAASNDEGIVVYNAQHENLVKSWVEGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ + + 
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQIAKEYRPEHGRWVG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISAAQLPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKNN--FTAYK 202


>gi|270261997|ref|ZP_06190269.1| iron(III)-binding periplasmic protein, precursor [Serratia
           odorifera 4Rx13]
 gi|270043873|gb|EFA16965.1| iron(III)-binding periplasmic protein, precursor [Serratia
           odorifera 4Rx13]
          Length = 338

 Score =  247 bits (631), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 92/198 (46%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS         + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFSAHAAPADDGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A  + +     + ++ + + 
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVEPQYRPQHGRWIG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+  ++  A LPKS+ DL   +WK R + +P+   F  +++ + +   +  
Sbjct: 127 IAARSTVFVYNPAKLTEAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKTN--FTAYK 202


>gi|227327906|ref|ZP_03831930.1| iron(III)-binding periplasmic protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 338

 Score =  247 bits (630), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 91/197 (46%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFSTE--NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + +L   G   + S       + + +Y  Q+++++   +  F + TG+K++    S  
Sbjct: 8   LSSAVLFASGLALSASANAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDT 67

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  S+ L  N DL   L    + +     +  + + + I
Sbjct: 68  ELGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKDTLAQVPSDYRPSHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +   A LPKS+ DL   +WK R + +P+   F  +++   +   +   
Sbjct: 128 AARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLELKGEKAT 187

Query: 178 QDFIKNITANEILTKYK 194
           Q+++K +  N   T YK
Sbjct: 188 QEWLKGMKEN--FTAYK 202


>gi|238789970|ref|ZP_04633749.1| Iron(III)-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
 gi|238721918|gb|EEQ13579.1| Iron(III)-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
          Length = 338

 Score =  247 bits (630), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 92/198 (46%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
            +    LL      AFS       + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   ALGPVALLASSMILAFSANAASSDEGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L      + +   + E+ +   
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDTATQAQVAKEYRPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISAAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             D++K +  N   T YK
Sbjct: 187 TLDWLKAMKTN--FTAYK 202


>gi|238751989|ref|ZP_04613474.1| Iron(III)-binding periplasmic protein [Yersinia rohdei ATCC 43380]
 gi|238709823|gb|EEQ02056.1| Iron(III)-binding periplasmic protein [Yersinia rohdei ATCC 43380]
          Length = 352

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 95/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++ +  LL       FS    +  + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 21  SLGSIALLASSIILTFSVNAASNDEGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 80

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +G  SP DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 81  SELGNQLVQEGAASPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEHGRWTG 140

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A+LPKS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 141 IAARSTVFVYNPEKISAAELPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 200

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 201 TLEWLKAMKTNS--TAYK 216


>gi|238784655|ref|ZP_04628660.1| Iron(III)-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
 gi|238714427|gb|EEQ06434.1| Iron(III)-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
          Length = 343

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 87/179 (48%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQGS--PVDVI 77
             +  K + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV 
Sbjct: 31  AASNDKSIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVF 90

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           +T++  ++ L  N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A 
Sbjct: 91  LTENSPAMVLVDNAKLFAPLDAETQAQVAKEYRPEHGRWSGIAARSTVFVYNPEKISEAQ 150

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           LPKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   T YK
Sbjct: 151 LPKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--FTAYK 207


>gi|61679630|pdb|1XVX|A Chain A, Crystal Structure Of Iron-Loaded Yersinia Enterocolitica
           Yfua
          Length = 312

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 88/178 (49%), Gaps = 8/178 (4%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQGS--PVDVII 78
           E+    + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +
Sbjct: 1   ESNDSGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFL 60

Query: 79  TKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
           T++  ++ L  N  L   L A    + +   + E+ +   I+  + V  Y+ ++I  A+L
Sbjct: 61  TENSPAMVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEKISEAEL 120

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           PKS+ DL   +WK R + +P+   F  +++ M +   +    +++K +  N   T YK
Sbjct: 121 PKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTN--FTAYK 176


>gi|206579888|ref|YP_002239383.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Klebsiella pneumoniae 342]
 gi|288936233|ref|YP_003440292.1| extracellular solute-binding protein family 1 [Klebsiella variicola
           At-22]
 gi|290510711|ref|ZP_06550081.1| iron(III) transport system substrate-binding protein [Klebsiella
           sp. 1_1_55]
 gi|206568946|gb|ACI10722.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Klebsiella pneumoniae 342]
 gi|288890942|gb|ADC59260.1| extracellular solute-binding protein family 1 [Klebsiella variicola
           At-22]
 gi|289777427|gb|EFD85425.1| iron(III) transport system substrate-binding protein [Klebsiella
           sp. 1_1_55]
          Length = 338

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 89/197 (45%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--S 61
           + T  L+      A      +    + +Y  Q+++++   +  F + TG+K++      S
Sbjct: 8   LRTAALVAASLFLAPQGMAADAQNGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDS 67

Query: 62  SIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
            +    + +GS  P DV +T++  S+ L  N  L   L A  +++     + ++ + + I
Sbjct: 68  ELGNQLVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDAATLQQVPAQYRPQHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +I  A LP S+ DL   +WK R + +P+   F  +++ M     +   
Sbjct: 128 AARSTVFVYNPAKISEAQLPHSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQAT 187

Query: 178 QDFIKNITANEILTKYK 194
            D++K +  N     YK
Sbjct: 188 LDWLKAMKTN--FVAYK 202


>gi|238894034|ref|YP_002918768.1| iron(III)-binding periplasmic protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238546350|dbj|BAH62701.1| iron(III)-binding periplasmic protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 338

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 89/197 (45%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--S 61
           + T  L+      A      +    + +Y  Q+++++   +  F + TG+K++      S
Sbjct: 8   LRTAALVAASLFLAPQGMAADAQNGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDS 67

Query: 62  SIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
            +    + +GS  P DV +T++  S+ L  N  L   L A  +++     + ++ + + I
Sbjct: 68  ELGNQLVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDAATLQQVPAQYRPQHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +I  A LP S+ DL   +WK R + +P+   F  +++ M     +   
Sbjct: 128 AARSTVFVYNPAKISEAQLPHSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQAT 187

Query: 178 QDFIKNITANEILTKYK 194
            D++K +  N     YK
Sbjct: 188 LDWLKAMKTN--FVAYK 202


>gi|238755861|ref|ZP_04617191.1| Iron(III)-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
 gi|238705946|gb|EEP98333.1| Iron(III)-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
          Length = 338

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 92/198 (46%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++ +  LL      AFS    +  + + +Y  Q+++++   +  F + TG+K+       
Sbjct: 7   SLGSIALLASSMMLAFSVNAASNDESIVVYNAQHENLVKSWVDGFTKDTGIKVILRNGGD 66

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    I +G  SP DV +T++  ++ L  N  L   L      + +   + E+ +   
Sbjct: 67  SELGNQLIQEGNASPADVFLTENSPAMVLVDNAKLFAPLDTATQAQVAKKYQPEHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A LPKS+ DL    WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISEAQLPKSIMDLAKPDWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKRN--FTAYK 202


>gi|253689288|ref|YP_003018478.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251755866|gb|ACT13942.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 338

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 92/197 (46%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFSTE--NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + +L   G   + S       + + +Y  Q+++++   +  F + TG+K++    S  
Sbjct: 8   LSSAVLFASGLALSASANAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDT 67

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  S+ L  N DL   L    + + S   +  + + + I
Sbjct: 68  ELGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKATLAQVSSDYRPSHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +   A LPKS+ DL   +WK R + +P+   F  +++   +   +   
Sbjct: 128 AARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLELKGEKAT 187

Query: 178 QDFIKNITANEILTKYK 194
           Q+++K +  N   T YK
Sbjct: 188 QEWLKGMKEN--FTAYK 202


>gi|227112821|ref|ZP_03826477.1| iron(III)-binding periplasmic protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 338

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 90/197 (45%), Gaps = 10/197 (5%)

Query: 6   IYTYLLLLCGFTEAFSTE--NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + +L   G   + S       + + +Y  Q+++++   +  F + TG+K++    S  
Sbjct: 8   LSSAVLFASGLALSASATAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVTLRNGSDT 67

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  S+ L  N +L   L    + +     +  + + + I
Sbjct: 68  ELGNQLVQEGKSSPADVFLTENSPSMVLVDNANLFAPLDNATLAQVPSDYRPSHGRWIGI 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +   A LPKS+ DL   +WK R + +P+   F  +++   +   +   
Sbjct: 128 AARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLELKGEQAT 187

Query: 178 QDFIKNITANEILTKYK 194
           Q ++K +  N   T YK
Sbjct: 188 QAWLKGMKEN--FTAYK 202


>gi|134455|sp|P21408|FBPA_SERMA RecName: Full=Fe(3+)-binding periplasmic protein; AltName:
           Full=Iron(III)-binding periplasmic protein; Flags:
           Precursor
 gi|152860|gb|AAA26573.1| iron transport protein (sufA) precursor [Serratia marcescens]
          Length = 338

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 91/198 (45%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENT--TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AF  +     + + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFGAQAASADQGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A  + +     +  + + + 
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+  ++  A LPKS+ DL   +WK R + +P+   F  +++ + +   +  
Sbjct: 127 IAARSTVFVYNPAKLSDAQLPKSLLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
              ++K +  N   T YK
Sbjct: 187 TLAWLKAMKTN--FTAYK 202


>gi|218681415|ref|ZP_03529312.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 894]
          Length = 338

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 79/181 (43%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            S     + L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP D
Sbjct: 24  GSAHAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGSDMQFANQIIQEGDASPAD 83

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++  ++ L     L   +    + +     +  +     I+  T V AY   ++  
Sbjct: 84  VFLTENSPAMTLVDGAGLFAPVEKDTLDQVPEQYRPADGMWTGIAARTTVFAYDKTKLSE 143

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R   +P    F  ++  + Q   +   + ++K +  N   T Y
Sbjct: 144 DKLPKSLLDLADPAWKGRWGASPAGADFQAIVAALLQLKGEDATKAWLKGLKDN--ATPY 201

Query: 194 K 194
           K
Sbjct: 202 K 202


>gi|297623762|ref|YP_003705196.1| family 1 extracellular solute-binding protein [Truepera
           radiovictrix DSM 17093]
 gi|297164942|gb|ADI14653.1| extracellular solute-binding protein family 1 [Truepera
           radiovictrix DSM 17093]
          Length = 329

 Score =  243 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 88/169 (52%), Gaps = 6/169 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDE 82
           + LT+Y+ +++  + P++  FE  TG+++   Y ++ +     + +G  SP DV   +D 
Sbjct: 22  QDLTVYSGRSEDFIAPLVERFEAETGLQVDVRYGNTAELAATLLEEGANSPADVFFPQDG 81

Query: 83  TSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L     E L  +LP  L+++     ++     + ++   +VLAY+T  +   +LP SV
Sbjct: 82  GALGAVAREGLFAELPGELLERVDARFRSPEGLWVGVTGRARVLAYNTDSVSEDELPASV 141

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           F+LT  QW+ R+  AP N SF   +  M     +   +++++ + AN +
Sbjct: 142 FELTEPQWQGRVGWAPTNASFQAFVTAMRLLEGEARTREWLEGMLANGV 190


>gi|170023704|ref|YP_001720209.1| extracellular solute-binding protein [Yersinia pseudotuberculosis
           YPIII]
 gi|169750238|gb|ACA67756.1| extracellular solute-binding protein family 1 [Yersinia
           pseudotuberculosis YPIII]
          Length = 339

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 87/195 (44%), Gaps = 8/195 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSI 63
               L     F  + +  +    + +Y  Q++S        F + TG+K++      S +
Sbjct: 10  HVALLASAILFASSANAASDEDGIIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSEL 69

Query: 64  QRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
               I +GS  P DV +T++  ++ L  N  L   L A  + + +   + E+ +   I+ 
Sbjct: 70  GNQLIQEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATLAQVAKEYRPEDGRWTGIAA 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQD 179
            + V  Y+  +I  ++LPKS+ DL   +WK R + +P+   F  +++ M     +    +
Sbjct: 130 RSTVFVYNPAKISESELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLE 189

Query: 180 FIKNITANEILTKYK 194
           ++K +  N   T YK
Sbjct: 190 WLKAMKTN--ATAYK 202


>gi|119963832|ref|YP_946554.1| iron(III)-binding protein [Arthrobacter aurescens TC1]
 gi|119950691|gb|ABM09602.1| iron(III)-binding protein [Arthrobacter aurescens TC1]
          Length = 349

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 89/201 (44%), Gaps = 13/201 (6%)

Query: 5   TIYTYLLLLCGF-----TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
            I T  L  CG       ++  +      +T+Y  Q++S+    I +F + TG+K++   
Sbjct: 15  AIATLGLSACGSNTTTAPDSSESAAAGDGITVYNAQHESLTKEWIDAFTKETGIKVTLRQ 74

Query: 60  TSSIQ--RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKK 113
            S  +     + +G  SP DV +T++  ++A   N  L   +    + +     +    K
Sbjct: 75  GSDTEMSNQIVQEGAASPADVFLTENSPAMAQVENAGLFADVDKATVDQVPAEFRPSTGK 134

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
              I+  + VL Y   +I    LPKS+ DL   +WK + + +P+   F  +++ + +   
Sbjct: 135 WTGIAARSTVLVYDKNKISDDQLPKSMLDLAKPEWKGKWAASPSGADFQAIVSALLELKG 194

Query: 174 KTVVQDFIKNITANEILTKYK 194
           +   ++++K +  N     YK
Sbjct: 195 EAATEEWLKGMKDN--FKAYK 213


>gi|619573|emb|CAA87394.1| YfuA precursor [Yersinia enterocolitica (type O:8)]
          Length = 338

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 94/198 (47%), Gaps = 10/198 (5%)

Query: 5   TIYTYLLLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           ++    LL      AFS   E+    + +Y  Q+++++   +  F + TG+K++      
Sbjct: 7   SLGPVALLASSMMLAFSANAESNDGGIVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGD 66

Query: 61  SSIQRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   
Sbjct: 67  SELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDAVTQAQVAQEYRREHGRWTG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  + V  Y+ ++I  A+L KS+ DL   +WK R + +P+   F  +++ M +   +  
Sbjct: 127 IAARSTVFVYNPEKISKAELAKSIMDLAKPEWKGRWAASPSGADFQAIVSAMLELKGEKA 186

Query: 177 VQDFIKNITANEILTKYK 194
             +++K +  N   T YK
Sbjct: 187 TLEWLKAMKTN--FTAYK 202


>gi|190893908|ref|YP_001980450.1| iron(III) ABC transporter substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190699187|gb|ACE93272.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 652]
          Length = 344

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            S     + L +Y  Q++S+    I +F + TG+K++      +Q     I +G  SP D
Sbjct: 30  SSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGGDMQFANQIIQEGDASPAD 89

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++  ++AL     L   +    + +     +  +     I+  T V AY   ++  
Sbjct: 90  VFLTENSPAMALVDGAGLFAPVEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTE 149

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R   AP    F  ++ ++ Q   +   + ++K +  N   T Y
Sbjct: 150 DKLPKSLLDLADPAWKGRWGAAPAGADFQAIVASLLQLKGEDATKAWLKGLKDN--ATPY 207

Query: 194 K 194
           K
Sbjct: 208 K 208


>gi|218516574|ref|ZP_03513414.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli 8C-3]
          Length = 344

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            S     + L +Y  Q++S+    I +F + TG+K++      +Q     I +G  SP D
Sbjct: 30  SSANAQDEGLVVYNAQHESLGREWIDAFTKETGIKVTMRQGGDMQFANQIIQEGDASPAD 89

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++  ++AL     L   +    + +     +  +     I+  T V AY   ++  
Sbjct: 90  VFLTENSPAMALVDGAGLFAPVEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTE 149

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R   AP    F  ++ ++ Q   +   + ++K +  N   T Y
Sbjct: 150 DKLPKSLLDLADPAWKGRWGAAPAGADFQAIVASLLQLKGEDATKAWLKGLKDN--ATPY 207

Query: 194 K 194
           K
Sbjct: 208 K 208


>gi|61679631|pdb|1XVY|A Chain A, Crystal Structure Of Iron-Free Serratia Marcescens Sfua
          Length = 309

 Score =  241 bits (615), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 84/175 (48%), Gaps = 8/175 (4%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQGS--PVDVIITKD 81
            + + +Y  Q+++++   +  F + TG+K++      S +    + +GS  P DV +T++
Sbjct: 1   DQGIVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSASPADVFLTEN 60

Query: 82  ETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             ++ L  N  L   L A  + +     +  + + + I+  + V  Y+  ++  A LPKS
Sbjct: 61  SPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPAKLSDAQLPKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           + DL   +WK R + +P+   F  +++ + +   +     ++K +  N   T YK
Sbjct: 121 LLDLAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLKAMKTN--FTAYK 173


>gi|51597001|ref|YP_071192.1| ABC transporter, periplasmic iron(III)-binding protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|153950683|ref|YP_001400329.1| iron ABC transporter permease [Yersinia pseudotuberculosis IP
           31758]
 gi|186896083|ref|YP_001873195.1| extracellular solute-binding protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|51590283|emb|CAH21920.1| ABC transporter, periplasmic iron(III)-binding protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|152962178|gb|ABS49639.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|186699109|gb|ACC89738.1| extracellular solute-binding protein family 1 [Yersinia
           pseudotuberculosis PB1/+]
          Length = 339

 Score =  241 bits (615), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 8/195 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSI 63
               L     F  + +  +    + +Y  Q++S        F + TG+K++      S +
Sbjct: 10  HVALLASAILFASSANAASDEDGIIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSEL 69

Query: 64  QRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
               I +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+ 
Sbjct: 70  GNQLIQEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEDGRWTGIAA 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQD 179
            + V  Y+  +I  ++LPKS+ DL   +WK R + +P+   F  +++ M     +    +
Sbjct: 130 RSTVFVYNPAKISESELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLE 189

Query: 180 FIKNITANEILTKYK 194
           ++K +  N   T YK
Sbjct: 190 WLKAMKTN--ATAYK 202


>gi|328951243|ref|YP_004368578.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451567|gb|AEB12468.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 333

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 50/168 (29%), Positives = 88/168 (52%), Gaps = 6/168 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQG--SPVDVIITKDE 82
           + L +Y+ +++S++ PII  FE  TG+ +   Y  + +     + +G  SP D+   +D 
Sbjct: 24  QELVIYSGRSKSLVEPIIQQFERETGINVRVKYGKTAELAVLLLEEGIRSPADLFWAQDA 83

Query: 83  TSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L      DL  KLP  ++ +     +NEN   + I+   + LAYS +R+K  +LPKS+
Sbjct: 84  GALGAVAKADLFVKLPESVVARVPEQFRNENGLWVAITGRARTLAYSPERVKPEELPKSI 143

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           FDLT+ +W  R+  AP N SF   +  M     +   + ++ ++ AN 
Sbjct: 144 FDLTDPKWAGRVGWAPTNASFQAFVTAMRVLYGEETTKQWLLDMKANG 191


>gi|22125423|ref|NP_668846.1| iron(III)-binding periplasmic protein [Yersinia pestis KIM 10]
 gi|45442361|ref|NP_993900.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108808142|ref|YP_652058.1| iron(III)-binding periplasmic protein [Yersinia pestis Antiqua]
 gi|108811586|ref|YP_647353.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|145599342|ref|YP_001163418.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides F]
 gi|149365176|ref|ZP_01887211.1| iron(III)-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|162419376|ref|YP_001607110.1| iron(III)-binding periplasmic protein [Yersinia pestis Angola]
 gi|165926936|ref|ZP_02222768.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939210|ref|ZP_02227760.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011140|ref|ZP_02232038.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212263|ref|ZP_02238298.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398365|ref|ZP_02303889.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421149|ref|ZP_02312902.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424455|ref|ZP_02316208.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467878|ref|ZP_02332582.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis FV-1]
 gi|167468492|ref|ZP_02333196.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis FV-1]
 gi|218930008|ref|YP_002347883.1| iron(III)-binding periplasmic protein [Yersinia pestis CO92]
 gi|229838546|ref|ZP_04458705.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229895612|ref|ZP_04510783.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides A]
 gi|229899111|ref|ZP_04514254.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901862|ref|ZP_04516983.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|270490046|ref|ZP_06207120.1| bacterial extracellular solute-binding protein [Yersinia pestis KIM
           D27]
 gi|294504715|ref|YP_003568777.1| iron(III)-binding periplasmic protein [Yersinia pestis Z176003]
 gi|21958311|gb|AAM85097.1|AE013755_6 solute-binding periplasmic protein for iron ABC transporter
           [Yersinia pestis KIM 10]
 gi|45437225|gb|AAS62777.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108775234|gb|ABG17753.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|108780055|gb|ABG14113.1| iron(III)-binding periplasmic protein [Yersinia pestis Antiqua]
 gi|115348619|emb|CAL21563.1| iron(III)-binding periplasmic protein [Yersinia pestis CO92]
 gi|145211038|gb|ABP40445.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides F]
 gi|149291589|gb|EDM41663.1| iron(III)-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|162352191|gb|ABX86139.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis Angola]
 gi|165912810|gb|EDR31437.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921287|gb|EDR38511.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989818|gb|EDR42119.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206194|gb|EDR50674.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960638|gb|EDR56659.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050869|gb|EDR62277.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056337|gb|EDR66106.1| iron(III) ABC transporter, permease protein, periplasmic
           iron(III)-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229680758|gb|EEO76853.1| iron(III)-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|229687513|gb|EEO79586.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229694912|gb|EEO84959.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701418|gb|EEO89446.1| iron(III)-binding periplasmic protein [Yersinia pestis Pestoides A]
 gi|262362777|gb|ACY59498.1| iron(III)-binding periplasmic protein [Yersinia pestis D106004]
 gi|262366702|gb|ACY63259.1| iron(III)-binding periplasmic protein [Yersinia pestis D182038]
 gi|270338550|gb|EFA49327.1| bacterial extracellular solute-binding protein [Yersinia pestis KIM
           D27]
 gi|294355174|gb|ADE65515.1| iron(III)-binding periplasmic protein [Yersinia pestis Z176003]
 gi|320014491|gb|ADV98062.1| iron(III)-binding periplasmic protein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 339

 Score =  240 bits (614), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 86/195 (44%), Gaps = 8/195 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSI 63
               L     F  + +  +    + +Y  Q++S        F + TG+K++      S +
Sbjct: 10  HVALLASAILFASSANAASDEDGIIIYNAQHESFAKSWAEGFTKDTGIKVTLRNGKDSEL 69

Query: 64  QRPPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
               I +GS  P DV +T++  ++ L  N  L   L A    + +   + E+ +   I+ 
Sbjct: 70  GNQLIQEGSSSPADVFLTENSPAMVLVDNAKLFAPLDAATQAQVAKEYRPEDGRWTGIAA 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQD 179
            + V  Y+  +I  A+LPKS+ DL   +WK R + +P+   F  +++ M     +    +
Sbjct: 130 RSTVFVYNPAKISEAELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLE 189

Query: 180 FIKNITANEILTKYK 194
           ++K +  N   T YK
Sbjct: 190 WLKAMKTN--ATAYK 202


>gi|241206796|ref|YP_002977892.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860686|gb|ACS58353.1| extracellular solute-binding protein family 1 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 338

 Score =  240 bits (614), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            S +   + L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP D
Sbjct: 24  GSAQAQDEGLVVYNAQHESLGREWIDAFSKETGIKVTMRQGSDMQFANQIIQEGDASPAD 83

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++  ++ L     L   +    + +     +  +     I+  T V AY   ++  
Sbjct: 84  VFLTENSPAMTLVDGAGLFAPIEKETLDQVPDQYRPADGMWTGIAARTTVFAYDKTKLTE 143

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R   AP    F  ++  + Q   +   + ++K +  N   T Y
Sbjct: 144 DKLPKSMLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGEDATKAWLKGLKDN--ATPY 201

Query: 194 K 194
           K
Sbjct: 202 K 202


>gi|238059298|ref|ZP_04604007.1| extracellular solute-binding protein [Micromonospora sp. ATCC
           39149]
 gi|237881109|gb|EEP69937.1| extracellular solute-binding protein [Micromonospora sp. ATCC
           39149]
          Length = 347

 Score =  240 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 6/184 (3%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--I 68
           L  CG  E    +   K LT+Y+ +++S++ P++  FE+ +GV +   Y ++ Q     +
Sbjct: 21  LTACGGDEGDPGKPGDKRLTIYSGRSESLVKPVLEKFEKSSGVTVDVRYGTTAQMAAQLL 80

Query: 69  TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
            +G  SP DV   +D  +L       L   LP  L+ +     +    + + +S  ++VL
Sbjct: 81  EEGGRSPADVFFAQDAGALGAVTKAGLFAVLPQDLLDRVPAAYRAAGGQWVGVSGRSRVL 140

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
           AY+  ++    LP SVF+LT+ +WK RL +AP N SF   +  +         ++F+  +
Sbjct: 141 AYNVDQVTKEQLPTSVFELTDPKWKGRLGVAPTNGSFQAFVTALRVQHGDAKAREFLTGL 200

Query: 185 TANE 188
            ANE
Sbjct: 201 KANE 204


>gi|222107061|ref|YP_002547852.1| ABC transporter substrate binding protein (iron) [Agrobacterium
           vitis S4]
 gi|221738240|gb|ACM39136.1| ABC transporter substrate binding protein (iron) [Agrobacterium
           vitis S4]
          Length = 329

 Score =  240 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 88/194 (45%), Gaps = 8/194 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            + + L        AF+ +     + +Y  Q++S+    + +F ++TG+K++    S +Q
Sbjct: 2   AVLSALFATTAIVPAFAADGD--GIVVYNAQHESLGREWVEAFTKQTGIKVTMRQGSDMQ 59

Query: 65  --RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  SP DV +T++  ++ L     L   + A  + +     +  N + + I+
Sbjct: 60  FANQLLQEGEASPADVFLTENSPAMTLVDQAGLFAPVDADTLAQVPEEFRPANGQWIGIA 119

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V AY   ++    LPKS+ DL +  WK R + +P+   F  +++ + +   +    
Sbjct: 120 ARSTVFAYDKTKLSEDKLPKSLLDLADPAWKGRWAASPSGADFQAIVSALLELKGEEATA 179

Query: 179 DFIKNITANEILTK 192
            ++K +  N    K
Sbjct: 180 KWLKALKENATFYK 193


>gi|284051124|ref|ZP_06381334.1| ferric iron-binding periplasmic protein of ABC transporter
           [Arthrospira platensis str. Paraca]
          Length = 334

 Score =  240 bits (613), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 92/198 (46%), Gaps = 8/198 (4%)

Query: 1   MFKRTIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           MFKR  +   +L        +  +++  + LT+Y+ + ++++ P+I   E++ G+ I   
Sbjct: 1   MFKRRHFLAGMLTLALVLGIAQVSQSQNQTLTIYSGRGEALIGPLIKQAEQQLGINIRVR 60

Query: 59  YTSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
           Y  + +     + +G  SP D+   +D  +L           +PA +I K     ++ N 
Sbjct: 61  YGDTAELAIAILEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQMISKVDSRFRSPNN 120

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
             + I+   +VLAY+T ++    LP S+ +LT  +W+ R+  AP N SF   +  M    
Sbjct: 121 HWVGITGRARVLAYNTNQVNRNQLPNSISELTQPKWRGRVGWAPTNGSFQSFVTAMRLVE 180

Query: 173 NKTVVQDFIKNITANEIL 190
                 ++++ +  N  +
Sbjct: 181 GDAKTLEWLQAMRNNGAV 198


>gi|291565974|dbj|BAI88246.1| putative iron ABC transporter substrate binding protein
           [Arthrospira platensis NIES-39]
          Length = 334

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 92/198 (46%), Gaps = 8/198 (4%)

Query: 1   MFKRTIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           MFKR  +   +L        +  +++  + LT+Y+ + ++++ P+I   E++ G+ I   
Sbjct: 1   MFKRRHFLAGMLTLALVLGLAQVSQSQNQTLTIYSGRGEALIGPLIKQAEQQLGINIRVR 60

Query: 59  YTSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
           Y  + +     + +G  SP D+   +D  +L           +PA +I K     ++ N 
Sbjct: 61  YGDTAELAIAILEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQMISKVDSRFRSPNN 120

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
             + I+   +VLAY+T ++    LP S+ +LT  +W+ R+  AP N SF   +  M    
Sbjct: 121 HWVGITGRARVLAYNTNQVNRNQLPNSISELTQPKWRGRVGWAPTNGSFQSFVTAMRLVE 180

Query: 173 NKTVVQDFIKNITANEIL 190
                 ++++ +  N  +
Sbjct: 181 GDAKTLEWLQAMRNNGAV 198


>gi|209524597|ref|ZP_03273145.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
 gi|209495055|gb|EDZ95362.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
          Length = 334

 Score =  238 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 93/198 (46%), Gaps = 8/198 (4%)

Query: 1   MFKRTIYTYLLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           MFKR  +   +L        +  +++  + LT+Y+ + ++++ P+I   E+  G+ I   
Sbjct: 1   MFKRRHFLAGMLTLALVLGIAQVSQSQNQTLTIYSGRQEALIGPLIKRAEQELGLNIRVR 60

Query: 59  YTSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
           Y  + +     I +G  SP D+   +D  +L           +PA +I +     ++ N 
Sbjct: 61  YGDTAELAIAIIEEGRNSPADIFFAQDAGALGALQKAGRTRAIPAQIISRVDSRFRSPNN 120

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
             + I+   +VLAY+T+++   +LP S+ +LT  +W+ R+  AP N SF   +  M    
Sbjct: 121 HWVGITGRARVLAYNTRQVNRNELPNSISELTQPKWRGRVGWAPTNGSFQSFVTAMRLVE 180

Query: 173 NKTVVQDFIKNITANEIL 190
                  +++ +  N ++
Sbjct: 181 GDAKTMQWLQAMRNNGVV 198


>gi|108798950|ref|YP_639147.1| extracellular solute-binding protein [Mycobacterium sp. MCS]
 gi|119868065|ref|YP_938017.1| extracellular solute-binding protein [Mycobacterium sp. KMS]
 gi|126434550|ref|YP_001070241.1| extracellular solute-binding protein [Mycobacterium sp. JLS]
 gi|108769369|gb|ABG08091.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           MCS]
 gi|119694154|gb|ABL91227.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           KMS]
 gi|126234350|gb|ABN97750.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           JLS]
          Length = 342

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 79/182 (43%), Gaps = 6/182 (3%)

Query: 16  FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG-- 71
              A S+ + +  L +Y  Q++S+    I +F + TG+K+S       +     + +G  
Sbjct: 24  GLAACSSSDDSDELLIYNAQHESLTKEWIDAFTKETGIKVSYRQGGDTELGNQLVAEGDA 83

Query: 72  SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           SP DV +T++  ++A      L   L A  I +     +    K   ++  + V  Y+  
Sbjct: 84  SPADVFLTENSPAMAAVERAGLFADLDAATIDQVPAQYRPATGKWTGVAARSTVFVYNPS 143

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           R+K   LPKS+ DL   +WK R    P    F  ++  + Q   +     ++  + AN +
Sbjct: 144 RLKADQLPKSLLDLQQPEWKGRWGAPPAKADFQAIVAALLQLEGEPATAQWLAGMKANAV 203

Query: 190 LT 191
           + 
Sbjct: 204 IY 205


>gi|312144399|ref|YP_003995845.1| extracellular solute-binding protein family 1 [Halanaerobium sp.
           'sapolanicus']
 gi|311905050|gb|ADQ15491.1| extracellular solute-binding protein family 1 [Halanaerobium sp.
           'sapolanicus']
          Length = 337

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 93/190 (48%), Gaps = 7/190 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           T+ T  +L    T   +       +T+Y+ ++++++ P+   F E TG++I+  Y  + +
Sbjct: 9   TVLTIAILFSSLT-FTALGAEAAEITIYSGRSENLIGPVFEMFTEETGIEINVNYGGTAE 67

Query: 65  RPP--ITQG--SPVDVIITKDETSLALNED--LLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  SP D+   +D  +L    D   L +LP   + K    L+++    +  S
Sbjct: 68  LAATILEEGQNSPADIFFAQDAGALGALADNDRLVELPEEYLNKVDSRLRSQEGLWLGTS 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
              +V+AY+T  +  A+LP +++   + +W+ R+  AP N SF   +  +     +   +
Sbjct: 128 GRARVVAYNTDYVDEAELPDTIWGFLDEEWQGRIGWAPTNGSFQAFVTALRVLEGEERAE 187

Query: 179 DFIKNITANE 188
           ++++ I AN+
Sbjct: 188 EWLRGIVANQ 197


>gi|330466473|ref|YP_004404216.1| extracellular solute-binding protein [Verrucosispora maris
           AB-18-032]
 gi|328809444|gb|AEB43616.1| extracellular solute-binding protein [Verrucosispora maris
           AB-18-032]
          Length = 352

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 94/191 (49%), Gaps = 10/191 (5%)

Query: 8   TYLLLLCGFTE----AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           T  L  CG  E      S ++  K +T+Y+ +N+ ++ P++  F E+TG+ ++  Y ++ 
Sbjct: 18  TVGLAACGSGEEDKATGSDQSADKQITVYSGRNEQLIKPLLDKFTEQTGIAVNARYANTA 77

Query: 64  QRPP--ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           Q     + +G  SP DV + +D  +L     + +   LP     K     +  N + + +
Sbjct: 78  QLAAQLVEEGDKSPADVFLAQDAGALGTVAKQGMFSTLPEATTAKVPATYRAGNGQWVGV 137

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           S   +VLAY+   +    LP SVFDLT   WK ++ +AP N SF   +  +    +    
Sbjct: 138 SARARVLAYNPDLVPADQLPASVFDLTGPAWKGKVGVAPTNASFQAFITAIRVQHDDAKA 197

Query: 178 QDFIKNITANE 188
           ++F++ + AN+
Sbjct: 198 EEFLRGLKAND 208


>gi|325962067|ref|YP_004239973.1| ABC-type Fe3+ transporter, periplasmic component [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468154|gb|ADX71839.1| ABC-type Fe3+ transport system, periplasmic component [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 350

 Score =  237 bits (604), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 80/174 (45%), Gaps = 6/174 (3%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITK 80
               +T+Y  Q++S+    I +F   TG+K++    S  +     I +G  SP DV +T+
Sbjct: 41  EGDGITVYNAQHESLTKEWIDAFTAETGIKVTMRQGSDTELSNQIIQEGDASPADVFLTE 100

Query: 81  DETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
           +  ++    N  L   + A  +++     +    K   I+  + VL Y   ++    LPK
Sbjct: 101 NSPAMTQVENAGLFADVDAATLEQVPAEFRPSTGKWTGIAARSTVLVYDKNKLTEDQLPK 160

Query: 139 SVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           S+ DL   +WK + + +P+   F  +++ + +   +   ++++K +  N    K
Sbjct: 161 SMLDLAKPEWKGKWAASPSGADFQAIVSALLELKGEAATEEWLKGMKDNYKAYK 214


>gi|116254310|ref|YP_770148.1| iron(III)-binding periplasmic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258958|emb|CAK10067.1| putative iron(III)-binding periplasmic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 340

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            S     + L +Y  Q++S+    I +F + TG+K++    S +Q     I +G  SP D
Sbjct: 26  GSANAQDEGLVVYNAQHESLGREWIAAFTKETGIKVTMRQGSDMQFANQIIQEGDASPAD 85

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           + +T++  ++ L     L   +    + +     +  +     I+  T V  Y   ++  
Sbjct: 86  IFLTENSPAMTLVDGAGLFAPIEKETLDQVPEQYRPADGMWTGIAARTTVFVYDKTKLTE 145

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R   AP    F  ++  + Q   +    D++K +  N   T Y
Sbjct: 146 DKLPKSMLDLADPAWKGRWGAAPAGADFQAIVAALLQLKGEQSTADWLKALKEN--ATPY 203

Query: 194 K 194
           K
Sbjct: 204 K 204


>gi|222084389|ref|YP_002542918.1| iron(III) ABC transporter [Agrobacterium radiobacter K84]
 gi|221721837|gb|ACM24993.1| iron(III) ABC transporter [Agrobacterium radiobacter K84]
          Length = 338

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 84/181 (46%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVD 75
            +    ++ + +Y  Q++++       F + TG+K++    S +Q     + +G  SP D
Sbjct: 24  MANAAESEGIVVYNAQHETLTQAWADGFTKETGIKVTIRNGSDMQFANQIVEEGAASPAD 83

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++   + L     L   + A  + +     K  +   + ++  + V AY   ++K 
Sbjct: 84  VYLTENSPGMTLVDANKLFAPVDADTLAQVPENFKAVDGNWVGVAARSTVFAYDKTKLKE 143

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
           ADLPKS+ DL + +WK R   +P    F  +++ + +   +   + ++K +  N   T Y
Sbjct: 144 ADLPKSLLDLADPKWKGRWGASPAGADFQAIVSALLELKGEDATKSWLKAMKEN--ATPY 201

Query: 194 K 194
           K
Sbjct: 202 K 202


>gi|159898246|ref|YP_001544493.1| extracellular solute-binding protein [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159891285|gb|ABX04365.1| extracellular solute-binding protein family 1 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 379

 Score =  235 bits (600), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 80/169 (47%), Gaps = 4/169 (2%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITK 80
               L +Y+ +++S++ P++  F + TG+ +   Y  + +     + +G  SP DV   +
Sbjct: 72  AGGSLVVYSGRSESLVAPLLELFTQETGIAVEVRYGDTAEMAAQILEEGDNSPADVFFGQ 131

Query: 81  DETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           D  +L    D   +L   L+        +     +  S   +VL Y+T  +   DLP S+
Sbjct: 132 DAGALGALSDRFVQLDRSLLNLVDPRFVSSEGTWVGASGRARVLVYNTDVLTSTDLPASI 191

Query: 141 FDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
            DLT  +WK R++ AP N S    +  +  +  + + + +++ + AN++
Sbjct: 192 LDLTKPEWKGRVAWAPTNGSLQAFVTALRVSQGEDMAKQWLEGMIANDV 240


>gi|116669173|ref|YP_830106.1| extracellular solute-binding protein [Arthrobacter sp. FB24]
 gi|116609282|gb|ABK02006.1| extracellular solute-binding protein, family 1 [Arthrobacter sp.
           FB24]
          Length = 351

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 81/179 (45%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVI 77
               +  +T+Y  Q++S+    + +F   TGVK++    S  +     I +G  SP DV 
Sbjct: 39  DGKVSGEITVYNAQHESLTKEWVDAFTAETGVKVTLRQGSDTEMSNQIIQEGAASPADVF 98

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           +T++  ++A   N  L   +    I +     +    K   I+  + VL Y   ++    
Sbjct: 99  LTENSPAMAQVENAGLFADVDKATIDQVPAEYRPSTGKWTGIAARSTVLVYDKAKLSEDQ 158

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           LPKS+ DL   +WK + + +P+   F  +++ + +   +   ++++K +  N     YK
Sbjct: 159 LPKSMLDLAKPEWKGKWAASPSGADFQAIVSALLELKGEAAAEEWLKGMKEN--FKAYK 215


>gi|209526494|ref|ZP_03275021.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
 gi|209493129|gb|EDZ93457.1| extracellular solute-binding protein family 1 [Arthrospira maxima
           CS-328]
          Length = 346

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 79/165 (47%), Gaps = 6/165 (3%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETS 84
           L +Y+ + + ++ P+   F+  TG++++  Y  + +     + +G  SP D+   +D  +
Sbjct: 43  LVVYSGRGEDLISPMFERFQAETGIQVNVRYGDTAELAATILEEGQNSPADIYFAQDAGA 102

Query: 85  LAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
           L     E     +P  L+ +     ++   + + I+   +V  Y+T  +    +P S+++
Sbjct: 103 LGALQREGRTRTIPETLLNQVDPRFRSREGQWIGITGRARVFNYNTNLLSSDQVPNSIWE 162

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           LT  +W  R+  AP N SF   +  + +   +   +++++ + AN
Sbjct: 163 LTQPEWSGRIGWAPTNGSFQSFVTALRKHEGEERAREWVEAMQAN 207


>gi|159037068|ref|YP_001536321.1| extracellular solute-binding protein [Salinispora arenicola
           CNS-205]
 gi|157915903|gb|ABV97330.1| extracellular solute-binding protein family 1 [Salinispora
           arenicola CNS-205]
          Length = 355

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 53/204 (25%), Positives = 102/204 (50%), Gaps = 16/204 (7%)

Query: 1   MFKRTIYTYL--------LLLCGFTEAFST--ENTTKYLTLYTDQNQSVMLPIIHSFEER 50
           +F+R+  T++        L+ CG  +  +   E   K +T+Y+ +N+ ++ P++  F E+
Sbjct: 8   LFRRSAATFVATGLVAVGLVACGSGQDDTDPGEPNDKIITVYSGRNEKLVKPLLERFTEQ 67

Query: 51  TGVKISPIYTSSIQRPP--ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNS 104
           TG++I P Y ++ Q     + +G  SP D+   +D  +L     + +   LP     K +
Sbjct: 68  TGIEIRPRYATTAQLAAQLVEEGDRSPADIFFAQDAGALGTVAKQGMFATLPETSTGKVT 127

Query: 105 FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRL 164
              +  + + + +S  ++VL Y+  ++    LP SVFDLT   WK ++++AP N SF   
Sbjct: 128 ETYRARSGQWVGVSARSRVLVYNADQVPADQLPTSVFDLTGPDWKGKVALAPTNASFQAF 187

Query: 165 LNTMEQTPNKTVVQDFIKNITANE 188
           +  +         +DF+  + ANE
Sbjct: 188 VTAIRVQHGDQRAKDFLSGLKANE 211


>gi|284052464|ref|ZP_06382674.1| extracellular solute-binding protein [Arthrospira platensis str.
           Paraca]
 gi|291566591|dbj|BAI88863.1| putative iron ABC transporter ATP-binding protein [Arthrospira
           platensis NIES-39]
          Length = 346

 Score =  234 bits (598), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 87/200 (43%), Gaps = 17/200 (8%)

Query: 5   TIYTYLLLLCGFTEAFSTENTT-----------KYLTLYTDQNQSVMLPIIHSFEERTGV 53
           ++    +     + A   + TT             L +Y+ + + ++ P+   F+  TG+
Sbjct: 8   SLIGLAIATSAISIACGQQQTTIDPTATNGTTGATLVVYSGRAEDLIGPMFQRFQAETGI 67

Query: 54  KISPIYTSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVL 107
           +++  Y  + +     + +G  SP D+   +D  +L     E     +P  L+ +     
Sbjct: 68  QVNVRYGDTAELAATILEEGQNSPADIYFAQDAGALGALQREGRTRPIPETLLNQVDPRF 127

Query: 108 KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNT 167
           ++   + + I+   +V  Y+T  +    +P S++++T  +W  R+  AP N SF   +  
Sbjct: 128 RSREGQWIGITGRARVFNYNTDLLSSDQVPNSIWEITQPEWSGRIGWAPTNGSFQSFVTA 187

Query: 168 MEQTPNKTVVQDFIKNITAN 187
           + +   +   +++++ + AN
Sbjct: 188 LRKHEGEERAREWVEAMQAN 207


>gi|260466700|ref|ZP_05812887.1| extracellular solute-binding protein family 1 [Mesorhizobium
           opportunistum WSM2075]
 gi|259029563|gb|EEW30852.1| extracellular solute-binding protein family 1 [Mesorhizobium
           opportunistum WSM2075]
          Length = 348

 Score =  234 bits (597), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 88/196 (44%), Gaps = 9/196 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SS 62
            +     L  G   A         + +Y  Q++S+       F + TG+K++      S 
Sbjct: 20  ALAGATALAIGLA-AGPAMAEDAGIIVYNAQHESLAKEWAAGFTKETGIKVTLRNGGDSD 78

Query: 63  IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  SP DV +T++  ++ L  N  L   + A  + +     +  + K + ++
Sbjct: 79  FSNQIVAEGTASPADVFLTENSPAMVLVENAGLFAPVDADTLAQVPQDYQAASGKWVGVA 138

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V AY+T ++K   LPKS+ DL +  WK R + +P+   F  +++ + Q   +    
Sbjct: 139 ARSTVFAYNTTKLKADQLPKSLLDLADPSWKGRWAASPSGADFQAIVSALLQLKGEAATA 198

Query: 179 DFIKNITANEILTKYK 194
           D++K + AN   T YK
Sbjct: 199 DWLKAMKAN--FTAYK 212


>gi|77459062|ref|YP_348568.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77383065|gb|ABA74578.1| iron(III)-binding periplasmic protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 337

 Score =  233 bits (595), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 80/178 (44%), Gaps = 8/178 (4%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ--RPPITQG--SPVDVII 78
              +  L +Y  Q++++    +  F E TG+ ++       +     + +G  SP DV +
Sbjct: 26  AADSVGLVVYNAQHETLTKAWVAGFTEETGIPVTVRNGDDTEMGNQIVQEGAASPADVFL 85

Query: 79  TKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
           T++  ++ L  N  L   +    +++     +  + + + I+  + V  Y+  ++   DL
Sbjct: 86  TENSPAMVLVDNAKLFAPVAPATLEQVDAAYRPAHGQWVGIAARSTVFVYNPAKLPEKDL 145

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
           PKS+ DL    WK R + +P    F  ++  + +   +    +++K + AN   T Y+
Sbjct: 146 PKSLMDLATPAWKGRWAASPAGADFQAIVAAVLEQKGEAATLEWLKGMKAN--FTAYR 201


>gi|220911513|ref|YP_002486822.1| extracellular solute-binding protein family 1 [Arthrobacter
           chlorophenolicus A6]
 gi|219858391|gb|ACL38733.1| extracellular solute-binding protein family 1 [Arthrobacter
           chlorophenolicus A6]
          Length = 352

 Score =  232 bits (593), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 4   RTIYTYLLLLCGFT--------EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI 55
                  L  CG +         + S    +  +T+Y  Q++S+    + +F   TG+K+
Sbjct: 14  AASAVLGLTACGGSTTPAATSSASGSAAGASGEITVYNAQHESLTKEWVDAFTSETGIKV 73

Query: 56  SPIYTSSIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKN 109
           +    S  +     I +G  SP DV +T++  ++    N DL   +    +++     + 
Sbjct: 74  TMRQGSDTELSNQIIQEGQASPADVFLTENSPAMTQVENADLFADVDKATLEQVPTEFQP 133

Query: 110 ENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTME 169
              K   I+  + VL Y   +I    LPKS+ DL   +WK + + +P    F  +++ + 
Sbjct: 134 STGKWTGIAARSTVLVYDKAKISEDQLPKSMLDLAKPEWKGKWAASPTGADFQAIVSALL 193

Query: 170 QTPNKTVVQDFIKNITANEILTKYK 194
           +   +   +++++ +  N     YK
Sbjct: 194 ELKGEDATEEWLQGMKEN--FKAYK 216


>gi|108804016|ref|YP_643953.1| extracellular solute-binding protein [Rubrobacter xylanophilus DSM
           9941]
 gi|108765259|gb|ABG04141.1| extracellular solute-binding protein, family 1 [Rubrobacter
           xylanophilus DSM 9941]
          Length = 372

 Score =  232 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 81/171 (47%), Gaps = 6/171 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGSPVDVIIT 79
                L +Y+ + + ++ P++  FEER+G+ +   Y  + +         + SP D+   
Sbjct: 62  PGEGNLIVYSGRTEDLVGPLMEQFEERSGIDVRVRYGDTAELAATILEEGENSPADLFFA 121

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           +D  +L     E  L  LP  ++ +     ++     +  S   +V+AY+T+ +  ++LP
Sbjct: 122 QDPGALGALAEEGRLRPLPQGILDRVGERFRSPEGLWVGTSGRARVVAYNTEELDPSELP 181

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            S++  T+ +W+ R+  AP N SF   +  +     +   + +++ I AN+
Sbjct: 182 DSIYGFTDPEWEGRIGWAPTNGSFQAFVTALRVLEGEERARAWLEGIQAND 232


>gi|111025325|ref|YP_707745.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110824304|gb|ABG99587.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 83/195 (42%), Gaps = 6/195 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
             + T        +++ +       +T+Y  Q++S+      +F   TG+++     S  
Sbjct: 16  AAVMTVSGCSDSGSDSGTDSGGANQITVYNAQHESLTQEWADAFTAETGIEVELRNGSDT 75

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  ++ L  N  L   +   ++ +     +  + K   I
Sbjct: 76  ELGNQLVAEGDQSPADVFLTENSPAMTLVENAGLFADVNQDVLDQVPSQYRPSSGKWTGI 135

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V AY+   +    LPKS+ DL +  WK R + +P+   F  +++ + +   +   
Sbjct: 136 AARSTVFAYNKDMLPQDQLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGEDAT 195

Query: 178 QDFIKNITANEILTK 192
           + ++  +  N    K
Sbjct: 196 RQWLAGMKDNVRTYK 210


>gi|239917160|ref|YP_002956718.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
 gi|281414370|ref|ZP_06246112.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
 gi|239838367|gb|ACS30164.1| ABC-type Fe3+ transport system, periplasmic component [Micrococcus
           luteus NCTC 2665]
          Length = 363

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 89/171 (52%), Gaps = 6/171 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDVIIT 79
            + K +TLY+ +++ ++ PI+  F + TG+++   Y  +     Q     +GSP DV ++
Sbjct: 51  ESDKKVTLYSGRSEDLVQPILDEFTDETGIEVEVRYDKTPAMAAQLVEEGEGSPADVFLS 110

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           +D  +L     E L   L    + +     +++    + ++   +VLAY+ +++  ADLP
Sbjct: 111 QDAGALGAVAKEGLFTPLAQETLDRVPETYRDDEGDWVGLTGRVRVLAYNEEKVPEADLP 170

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
            SV +LT+ +WK R+ +AP N SF   +  +     +   + ++++  AN+
Sbjct: 171 TSVDELTDPKWKGRVGVAPTNASFQTFVTALRLQKGEDEARTWLEDFAAND 221


>gi|226349510|ref|YP_002776624.1| putative iron(III) ABC transporter iron(III)-binding protein
           [Rhodococcus opacus B4]
 gi|226245425|dbj|BAH55772.1| putative iron(III) ABC transporter iron(III)-binding protein
           [Rhodococcus opacus B4]
          Length = 345

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 85/197 (43%), Gaps = 11/197 (5%)

Query: 6   IYTYLLLLCGFTEAFST----ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
               +L + G +++ S           +T+Y  Q++S+      +F   TG+++     S
Sbjct: 14  ATAAVLTVAGCSDSGSDNGTDSGAANQITVYNAQHESLTQEWADAFTAETGIEVELRNGS 73

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
             +     + +G  SP DV +T++  ++ L  N  L   +   ++ +     +  + K  
Sbjct: 74  DTELGNQLVAEGDQSPADVFLTENSPAMTLVENAGLFADVHRDVLDQVPGQYRPSSGKWT 133

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            I+  + V AY+   +    LPKS+ DL +  WK R + +P+   F  +++ + +   + 
Sbjct: 134 GIAARSTVFAYNKDML-PDQLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGED 192

Query: 176 VVQDFIKNITANEILTK 192
             + ++  +  N    K
Sbjct: 193 ATRQWLAGMKENVRTYK 209


>gi|13473018|ref|NP_104585.1| iron-binding periplasmic protein; sfuA protein precursor
           [Mesorhizobium loti MAFF303099]
 gi|14023766|dbj|BAB50371.1| iron-binding periplasmic protein; SfuA protein precursor
           [Mesorhizobium loti MAFF303099]
          Length = 335

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 88/196 (44%), Gaps = 9/196 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SS 62
            +     L  G     +T      + +Y  Q++S+       F + TG+K++      S 
Sbjct: 7   ALVGATALAIGLAVGPATAGDAG-IIVYNAQHESLAKEWAEGFTKETGIKVTLRNGGDSD 65

Query: 63  IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  SP DV +T++  ++ L  N  L   + A  + +     +  + K + ++
Sbjct: 66  FSNQIVAEGAASPADVFLTENSPAMVLVENAGLFAPVDADTLAQVPQDYQATSGKWVGVA 125

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V AY+T ++K   LPKS+ DL +  WK R + +P+   F  +++ + Q   +    
Sbjct: 126 ARSTVFAYNTTKLKADQLPKSLLDLADPSWKGRWAASPSGADFQAIVSALLQLKGEAATA 185

Query: 179 DFIKNITANEILTKYK 194
           D++K +  N   T YK
Sbjct: 186 DWLKAMKQN--FTAYK 199


>gi|319781302|ref|YP_004140778.1| extracellular solute-binding protein family 1 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167190|gb|ADV10728.1| extracellular solute-binding protein family 1 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 335

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 83/181 (45%), Gaps = 8/181 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQG--SPVD 75
              +     + +Y  Q++S+       F + TG+K++      S      + +G  SP D
Sbjct: 21  GPAKAEEDGIIVYNAQHESLTKAWAEGFTKETGIKVTVRNGGDSDFSNQIVAEGAASPAD 80

Query: 76  VIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V +T++  ++AL  +  L   + A  + +     +  + K + ++  + V AY+  ++  
Sbjct: 81  VFLTENSPAMALVESAGLFAPVDADTLAQVPQDYQPASGKWVGVAARSTVFAYNKTKLTA 140

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             LPKS+ DL +  WK R + +P+   F  +++ + Q   +    D++K +  N   T Y
Sbjct: 141 DQLPKSMLDLADPSWKGRWAASPSGADFQAIVSALLQLKGEAATADWLKAMKTN--FTAY 198

Query: 194 K 194
           K
Sbjct: 199 K 199


>gi|111023981|ref|YP_706953.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110823511|gb|ABG98795.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 83/195 (42%), Gaps = 6/195 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
             + T        +++ +       +T+Y  Q++S+      +F   TG+++     S  
Sbjct: 16  AAVMTVSGCSDSGSDSGTDSGGANQITVYNAQHESLTQEWADAFTAETGIEVELRNGSDT 75

Query: 64  QR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  SP DV +T++  ++ L  N  L   +   ++ +     +  + K   I
Sbjct: 76  ELGNQLVAEGDQSPADVFLTENSPAMTLVENAGLFADVNQDVLDQVPGQYRPSSGKWTGI 135

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V AY+   +    LPKS+ DL +  WK R + +P+   F  +++ + +   +   
Sbjct: 136 AARSTVFAYNKDTLPQDQLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALLELKGEDAT 195

Query: 178 QDFIKNITANEILTK 192
           + ++  +  N    K
Sbjct: 196 RQWLAGMKDNVRTYK 210


>gi|70730403|ref|YP_260144.1| iron(III) ABC transporter periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68344702|gb|AAY92308.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 337

 Score =  231 bits (589), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 89/193 (46%), Gaps = 6/193 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SS 62
            +   LL+    T   +       L +Y  Q++ +    +  F   TG+K++      S 
Sbjct: 8   RLKAGLLVGALLTAGHAYAADADGLLVYNAQHEGLTKAWVEGFTRDTGIKVTLRNGDDSE 67

Query: 63  IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
           +    + +G  SP DV +T++  ++AL  N  L  K+    +++ +   +  +   + I+
Sbjct: 68  MGNQMVQEGQASPADVFLTENSPAMALVDNAGLFAKVAPTTLEQVAAAYRPTHGNWVGIA 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + V  Y+  +++ ADLPKS+ DL N  WK R + +P    F  +++ + +   +    
Sbjct: 128 ARSTVFVYNPAKLQQADLPKSLLDLANPAWKGRWAASPAGADFQAIVSAVLELKGEAATL 187

Query: 179 DFIKNITANEILT 191
           +++K + +N  L 
Sbjct: 188 EWLKGMKSNASLY 200


>gi|317121340|ref|YP_004101343.1| extracellular solute-binding protein family 1 [Thermaerobacter
           marianensis DSM 12885]
 gi|315591320|gb|ADU50616.1| extracellular solute-binding protein family 1 [Thermaerobacter
           marianensis DSM 12885]
          Length = 380

 Score =  231 bits (589), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 92/191 (48%), Gaps = 11/191 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +  ++L  CG        +  + L +Y+ + QS++ P++  F   TG+ I   Y S+ +
Sbjct: 53  ALAGFVLSGCGVL----GRSGRQELVVYSSRTQSLVHPLLEQFARETGIDIKVRYASTAE 108

Query: 65  RP--PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                + +G  S  DV+   D           LL +LP  +++K     ++ + + + +S
Sbjct: 109 LVNTLLEEGERSAADVLYLADAGGWGPLRQAGLLAELPQDVLEKVDPRFRSPDGQWVGVS 168

Query: 119 FDTQVLAYSTKRIKIA-DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
             ++V+ Y+  +I    DLP SV DLT+ +WK R+  AP +  +  L+  +  T  +   
Sbjct: 169 GRSKVIVYNKNKIDPGRDLPDSVMDLTDPKWKGRIGWAPTHGEWQILVTAIRLTKGEDAA 228

Query: 178 QDFIKNITANE 188
           + +++ + AN+
Sbjct: 229 RQWLEGMKAND 239


>gi|111020133|ref|YP_703105.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
 gi|110819663|gb|ABG94947.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Rhodococcus
           jostii RHA1]
          Length = 346

 Score =  230 bits (588), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 86/203 (42%), Gaps = 11/203 (5%)

Query: 1   MFKRTIYTYLLLLCGF-----TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI 55
           M    + T  ++         ++  +       +T+Y  Q++S+      +F   TG+++
Sbjct: 8   MSGLALATAAVMTVSGCSNSGSDGGTDSGGANQITVYNAQHESLTQEWADAFTAETGIEV 67

Query: 56  SPIYTSSIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKN 109
                S  +     + +G  SP DV +T++  ++ L  N  L   +   ++ +     + 
Sbjct: 68  ELRNGSDTELGNQLVAEGDQSPADVFLTENSPAMTLVENAGLFADVNQDVLDQVPSQYRP 127

Query: 110 ENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTME 169
            + K   I+  + V AY+  ++    LPKS+ DL +  WK R + +P+   F  +++ + 
Sbjct: 128 SSGKWTGIAARSTVFAYNKDKLPQDQLPKSLLDLQDPAWKDRWAASPSGADFQAIVSALL 187

Query: 170 QTPNKTVVQDFIKNITANEILTK 192
           +   +    +++  +  N    K
Sbjct: 188 ELKGEDATGEWLAGMKDNVRTYK 210


>gi|260222284|emb|CBA31694.1| Fe(3+)-binding periplasmic protein [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 357

 Score =  230 bits (586), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 40/200 (20%), Positives = 86/200 (43%), Gaps = 9/200 (4%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F+       +   G   A +   + + + +Y  Q+ S+    + +F + TG+K++    
Sbjct: 25  LFRLAALGAAIATVGLP-AQAQTPSAEGILVYNAQHASLTQAWVEAFTKETGIKVTLRQG 83

Query: 61  SSIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
           S  +     + +G  SP DV +T++  ++AL     L   L    I   +   +  + + 
Sbjct: 84  SDTELGNQLVQEGAASPADVFLTENSPAMALVDGAGLFAPLDPATINLIAPSYRTAHGRW 143

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           + I+  + V  Y   +     LPKS+ DL   +WK R + +P    F  +++ + +   +
Sbjct: 144 VGIAARSTVFVYKKTKFTPEQLPKSLMDLAKPEWKSRWAASPAGADFQAIVSAVLELKGE 203

Query: 175 TVVQDFIKNITANEILTKYK 194
                ++K +  N +   YK
Sbjct: 204 AATAAWLKGMKENVV--PYK 221


>gi|119511514|ref|ZP_01630623.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
 gi|119463825|gb|EAW44753.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
          Length = 349

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 84/197 (42%), Gaps = 13/197 (6%)

Query: 4   RTIYTYLLLLC-------GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS 56
            T    L + C             +     K L +Y+ +N+ ++  +I  FE +   K+ 
Sbjct: 13  ATASGGLAVACDANSNPTATDLGQTATELEKELVIYSGRNEKLIGELIKQFETQANTKVQ 72

Query: 57  PIYTSSIQRP--PITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNE 110
             Y  + +     + +G  SP DV   +D  +L          +LP  L+ K     ++ 
Sbjct: 73  VRYGDTAELASAILEEGTNSPADVFFAQDAGALGAIQKAGRTVELPTSLLNKVDSAYRSP 132

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQ 170
             + + ++   + + Y+T  +K  +LP S+F  T+ +W+ ++  AP N SF   +  +  
Sbjct: 133 EGQWVGVTGRVRTVDYNTNLVKAEELPSSIFGFTDPKWQGKIGWAPTNGSFQSFVTALRV 192

Query: 171 TPNKTVVQDFIKNITAN 187
              +   +++++ I AN
Sbjct: 193 AEGEERAKEWLEGIKAN 209


>gi|269929109|ref|YP_003321430.1| extracellular solute-binding protein family 1 [Sphaerobacter
           thermophilus DSM 20745]
 gi|269788466|gb|ACZ40608.1| extracellular solute-binding protein family 1 [Sphaerobacter
           thermophilus DSM 20745]
          Length = 394

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 85/178 (47%), Gaps = 6/178 (3%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--S 72
             A +T      LT+Y+ +++ ++  I+  F   +GV++   Y  + +     + +G  S
Sbjct: 77  AGAPATGTVGGSLTVYSGRSEQLIQAIVDQFAAASGVEVKVRYGDTAEMAAAILEEGQSS 136

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P D+   +D  +L     E LL +LPA ++       ++ +   + IS   + + Y+T+R
Sbjct: 137 PADIFFAQDAGALGAVAREGLLAELPADVLDLVEARFRSPDGLWVGISGRARAVVYNTER 196

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           +  +D+P S+ D T+  WK RL  AP N SF   +  +       V + +++ I  N 
Sbjct: 197 LSESDIPPSILDFTDPVWKDRLGWAPTNASFQAAVTAIRVLRGDDVARAWLEGIRDNG 254


>gi|119511513|ref|ZP_01630622.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
 gi|119463824|gb|EAW44752.1| ferric iron-binding periplasmic protein of ABC transporter
           [Nodularia spumigena CCY9414]
          Length = 330

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 88/192 (45%), Gaps = 6/192 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           +     L  +       S    TK LT+Y+ + + ++ P++   ++  G+ I   Y  + 
Sbjct: 2   KATAGALAFMLTSGIGLSVNAQTKTLTIYSGRGEKLIGPLLEQAKKDLGMNIQVRYGDTA 61

Query: 64  QRPP--ITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +     + +G  S  D+   +D  +L L E  +L   + ++L+ +     ++   K + I
Sbjct: 62  ELAIALVEEGKNSRADLYFAQDAGALGLLERRNLTLPISSNLLNQVDPRFRSPQGKWLGI 121

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           S   + L Y+T  +K   LPKSV+DL   QW+ +++ AP N SF   +  M     +   
Sbjct: 122 SGRARTLNYNTNLVKKEQLPKSVWDLVKPQWRGKVAWAPTNGSFQSFVTAMRVLEGEPRT 181

Query: 178 QDFIKNITANEI 189
             ++K + AN +
Sbjct: 182 LQWLKAMKANGV 193


>gi|288957451|ref|YP_003447792.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
 gi|288909759|dbj|BAI71248.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
          Length = 347

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 6/180 (3%)

Query: 16  FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG-- 71
            + +  T  + + +T+Y  Q+ S+    +  F   TG+K++    S ++     + +G  
Sbjct: 28  GSASAQTAPSAEGITVYNAQHASLAKEWVERFSRETGIKVTVRNGSDMELGNQIVQEGAA 87

Query: 72  SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           SP DV +T++  ++AL  N  L   L A  +       +  N   + I+  + V AY+T 
Sbjct: 88  SPADVFLTENSPAMALVDNAGLFAPLGAETLASVPENFRPANGHWVGIAARSTVFAYNTG 147

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
           ++    LPKS+ DL   +WK R + +P    F  ++  + Q   +T    ++K +  N  
Sbjct: 148 KLTRDKLPKSLLDLATPEWKGRWAASPAGADFQAIVGALLQLKGETATASWLKAMKENAK 207


>gi|84495089|ref|ZP_00994208.1| iron-binding periplasmic protein; sfuA protein precursor
           [Janibacter sp. HTCC2649]
 gi|84384582|gb|EAQ00462.1| iron-binding periplasmic protein; sfuA protein precursor
           [Janibacter sp. HTCC2649]
          Length = 371

 Score =  227 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 82/184 (44%), Gaps = 8/184 (4%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--S 72
           +   S       +T+Y  Q++ +    + +F + TGVK++    S  +     + +G  S
Sbjct: 54  SAPSSNAKVEGAITVYNAQHEELSQAWVDAFTKETGVKVTIRNGSDTELSNQIVAEGKAS 113

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV +T++  ++A   N DL   +    +++     +    K   I+  + VL Y  ++
Sbjct: 114 PADVFLTENSPAMAQVENADLFADVDKATLEQVPSQFRPSTAKWTGIAARSTVLVYDKRK 173

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           +K  +LPKS+ DL   +WK R + +P    F  ++  + +       + ++  +  N   
Sbjct: 174 VKEDELPKSMLDLAKPEWKGRWAASPTGADFQAIVAALIELKGADAAEQWLTAMKQNAK- 232

Query: 191 TKYK 194
             YK
Sbjct: 233 -PYK 235


>gi|119716254|ref|YP_923219.1| extracellular solute-binding protein [Nocardioides sp. JS614]
 gi|119536915|gb|ABL81532.1| extracellular solute-binding protein, family 1 [Nocardioides sp.
           JS614]
          Length = 333

 Score =  226 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 85/196 (43%), Gaps = 6/196 (3%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            KR      L L     A    + +  L +Y  Q++ +M  +  +F + TG+ +      
Sbjct: 1   MKRVPALLALSLAATLLATGCGSDSDALVIYNAQHEELMTDVAKAFTDETGIDVELRNGK 60

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
            ++     + +G  SP DV +T++  ++A   N  L  +LP   +     + +  +    
Sbjct: 61  DLEMSAQLVAEGKASPADVFLTENSPAMAQVENAGLFTELPQDAVAPIPAMYRPRSGLWT 120

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
                + VL Y+T ++   +LP S+ DL + +WK R+S +P    F  ++  +     + 
Sbjct: 121 GFVARSTVLVYNTDQVSADELPDSILDLADPEWKGRISFSPTGADFQAIVAAVLDLEGEQ 180

Query: 176 VVQDFIKNITANEILT 191
             + +++ I AN  + 
Sbjct: 181 KTRAWLEGIKANGTVY 196


>gi|145223445|ref|YP_001134123.1| extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]
 gi|145215931|gb|ABP45335.1| extracellular solute-binding protein, family 1 [Mycobacterium
           gilvum PYR-GCK]
          Length = 341

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 75/190 (39%), Gaps = 6/190 (3%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           +         L     A S+      L +Y  Q++S+    I +F + TG+K++      
Sbjct: 10  RIVALIVAGGLAAGLTACSSSEEEDGLLVYNAQHESLTKEWIDAFTKETGIKVTYRQGGD 69

Query: 63  IQR--PPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMR 116
            +     I +G  SP DV +T++  ++A  E   L   +    I +     +    K   
Sbjct: 70  TELGNQLIAEGDASPADVFLTENSPAMAAVERDGLFTDVDEATIAQVPPQFRPATSKWTG 129

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           ++  T V AY   ++  A LP S+ DL   +WK R    P    F  ++  M +   +  
Sbjct: 130 VAARTTVFAYDKTKLTEAQLPTSIMDLEKPEWKGRWGAPPVKPDFQAIVAAMLELTGERA 189

Query: 177 VQDFIKNITA 186
              ++  + A
Sbjct: 190 TGQWLAGMKA 199


>gi|17228877|ref|NP_485425.1| ferric iron-binding periplasmic protein of ABC transporter [Nostoc
           sp. PCC 7120]
 gi|17130729|dbj|BAB73339.1| ferric iron-binding periplasmic protein of ABC transporter [Nostoc
           sp. PCC 7120]
          Length = 336

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 89/192 (46%), Gaps = 6/192 (3%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           ++       ++ G     +   T K LT+Y+ +++ +M P+I   ++  G+ I   Y  S
Sbjct: 7   RQISSAITAIVLGLGLGIAVAATPKTLTVYSGRDEEIMRPLIERAKKDLGLNIEVRYGDS 66

Query: 63  IQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
            +     I +G  S  DV   +D  SL     E    KLP+ L+ K     ++   + + 
Sbjct: 67  TELAIALIEEGKNSRADVFYAQDAGSLGAIGREGKAVKLPSQLLNKVDSRFRSPAGEWVG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           IS   +V+ Y+TK +K  +LPKSV  L++ +W+ ++  AP N SF   +  M        
Sbjct: 127 ISGRARVIDYNTKLVKANELPKSVMQLSDRKWRGKVGWAPTNGSFLSFVTAMRLMEGDQK 186

Query: 177 VQDFIKNITANE 188
              ++K + AN 
Sbjct: 187 TLAWLKAMKANG 198


>gi|254780563|ref|YP_003064976.1| extracellular solute-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040240|gb|ACT57036.1| extracellular solute-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 195

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 195/195 (100%), Positives = 195/195 (100%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT
Sbjct: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60

Query: 61  SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
           SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD
Sbjct: 61  SSIQRPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
           TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF
Sbjct: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180

Query: 181 IKNITANEILTKYKR 195
           IKNITANEILTKYKR
Sbjct: 181 IKNITANEILTKYKR 195


>gi|271969332|ref|YP_003343528.1| iron ABC transporter periplasmic iron-binding protein
           [Streptosporangium roseum DSM 43021]
 gi|270512507|gb|ACZ90785.1| iron ABC transporter, periplasmic iron-binding protein
           [Streptosporangium roseum DSM 43021]
          Length = 340

 Score =  225 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 39/188 (20%), Positives = 81/188 (43%), Gaps = 8/188 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              L   CG             L +Y+ +N++++ P+I      TG+ +   Y  S +  
Sbjct: 14  LALLASACGGDGGDGQSFGDDSLVIYSGRNKNLVGPLIDKLRTATGLDVQVRYGDSAELA 73

Query: 67  P--ITQG--SPVDVIITKDETSLALNED--LLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
              + +G  S  DV  ++D  +L       +L  +P  L+ + +   +      + +S  
Sbjct: 74  AQILEEGADSRADVFFSQDAGALGALSKHRMLAPVPPELLDRVAARYRGSEGTWVGVSGR 133

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDF 180
           ++V+ Y  + +     PKSVF+LT  +WK ++  +P N SF   +  +     +   + +
Sbjct: 134 SRVIVYDPRTVAA--PPKSVFELTGPKWKDKVGWSPTNASFQSFVTALRVVAGEDRARQW 191

Query: 181 IKNITANE 188
           ++ + AN 
Sbjct: 192 LEAMKANG 199


>gi|119855136|ref|YP_935741.1| extracellular solute-binding protein [Mycobacterium sp. KMS]
 gi|119697854|gb|ABL94926.1| extracellular solute-binding protein, family 1 [Mycobacterium sp.
           KMS]
          Length = 341

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 6/179 (3%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPV 74
           A S+      L +Y  Q++S+    I +F + TG+K++       +     I +G  SP 
Sbjct: 26  ACSSSEEEDGLLIYNAQHESLTKEWIDAFTKETGIKVTYRQGGDTELGNQLIAEGDSSPA 85

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DV +T++  ++A  E   L   +    I +     +    K   ++  T V AY   ++ 
Sbjct: 86  DVFLTENSPAMAAVEKDGLFTDVDQATISQVPPQFRPTTSKWTGVAARTTVFAYDKTKLT 145

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILT 191
            A LP+S+ DL   +WK R    P    F  ++  M +   +     ++  + AN  + 
Sbjct: 146 EAQLPRSIMDLEKPEWKGRWGAPPVKPDFQAIVAAMLELTGEQATSAWLSAMKANAEIY 204


>gi|313902584|ref|ZP_07835984.1| extracellular solute-binding protein family 1 [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467150|gb|EFR62664.1| extracellular solute-binding protein family 1 [Thermaerobacter
           subterraneus DSM 13965]
          Length = 403

 Score =  224 bits (572), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 91/189 (48%), Gaps = 12/189 (6%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
             ++L  CG           + L +Y+ + QS++ P++  F + TG+ I   Y S+ +  
Sbjct: 79  AGFVLAGCG-----PLGGGNQQLVIYSSRTQSLVHPLLEQFAKETGIDIRVRYGSTAELV 133

Query: 67  --PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFD 120
              + +G  +  DV+   D           LL +LP  +++K     ++ + + + +S  
Sbjct: 134 NTLLEEGDRTEADVLYLSDAGGWGPLREAGLLAQLPQDVLEKVDPRFRSPDGQWVGVSGR 193

Query: 121 TQVLAYSTKRIKIA-DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQD 179
           ++V+ Y+  RI  A DLP SV  LT+ +WK R+  AP +  +  L+  +  T  +   + 
Sbjct: 194 SKVIVYNKDRIDPARDLPDSVMALTDPKWKGRVGWAPTHGEWQILVTAIRLTRGEEAARQ 253

Query: 180 FIKNITANE 188
           +++ + ANE
Sbjct: 254 WLEGMKANE 262


>gi|288922155|ref|ZP_06416357.1| extracellular solute-binding protein family 1 [Frankia sp. EUN1f]
 gi|288346515|gb|EFC80842.1| extracellular solute-binding protein family 1 [Frankia sp. EUN1f]
          Length = 343

 Score =  224 bits (571), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 79/191 (41%), Gaps = 6/191 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
                  L  CG   + ++      L LY  Q+  V       F  +TG+K+     S  
Sbjct: 13  AAWTGLALAACGSDSSPASSGPDGALVLYNAQHDEVGKAWADGFTAKTGIKVDIRNGSDF 72

Query: 64  QRP----PITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           +         + SP DV IT++  +++L   + L   + A    +      +     + +
Sbjct: 73  ELANQIVAEGESSPADVFITENSPAMSLVSAKGLFAPVDAATRAQVPARYSSGKGDWVGV 132

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +  + V  Y+  +I  ADLPKS+ DL   +WK R +++P+   F  +++ +     +   
Sbjct: 133 AARSTVFIYNPGKIPAADLPKSIIDLARPEWKGRYAVSPSGADFQAVVSAVYALRGQDEG 192

Query: 178 QDFIKNITANE 188
           + +++ I  N 
Sbjct: 193 RAWLQGIKDNA 203


>gi|326332539|ref|ZP_08198811.1| iron(III)-binding protein [Nocardioidaceae bacterium Broad-1]
 gi|325949662|gb|EGD41730.1| iron(III)-binding protein [Nocardioidaceae bacterium Broad-1]
          Length = 336

 Score =  224 bits (571), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 81/181 (44%), Gaps = 6/181 (3%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGS 72
               ++ ++   L +Y  Q++ +M  ++ +FE+ TG+ +       ++         + S
Sbjct: 19  GATLTSCSSGDALVVYNAQHEQLMEELVPAFEKETGIDVELRNGKDLELAAQLVAEGEKS 78

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV +T++  ++A    E LL  LP  +        +  +         + VL Y+T  
Sbjct: 79  PADVFLTENSPAMAAVEREGLLATLPDDVTAPIPEQYRPTSNAWTGFVARSTVLVYNTDE 138

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           I  A+LP S+ DL   +WK ++S +P    F  ++  +  T  +   + +++ I AN  +
Sbjct: 139 ITEAELPASMLDLAKPEWKGKVSFSPTGADFQAIVAGVLATEGEAATKAWLEGIKANGTV 198

Query: 191 T 191
            
Sbjct: 199 Y 199


>gi|260771842|ref|ZP_05880760.1| ferric iron ABC transporter iron-binding protein [Vibrio
           metschnikovii CIP 69.14]
 gi|260613134|gb|EEX38335.1| ferric iron ABC transporter iron-binding protein [Vibrio
           metschnikovii CIP 69.14]
          Length = 332

 Score =  223 bits (570), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 50/193 (25%), Positives = 96/193 (49%), Gaps = 8/193 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            ++ + + + L+     A         +TLY+ + ++++ PII  FE+++G+K++  Y  
Sbjct: 1   MQKKLLSTVALVSSLITAPLLHAQD--ITLYSGRGETLVKPIIEQFEKQSGIKVNVRYGD 58

Query: 62  SIQRP--PITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
           + Q       +G  SP DV   +D  ++    N  LL  LP  + K+   +  ++  + +
Sbjct: 59  TAQLAVLLQEEGARSPADVYWGQDAGAMGALANAGLLATLPEAVYKQLPEIYTSKTGQWV 118

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
             S  ++V+AYST+R    D+P SVFDLT+ +++ R  +AP N  F   +  M       
Sbjct: 119 AASGRSRVIAYSTERASAEDIPASVFDLTSEKYQGRFGLAPTNGGFQSFVTAMRVQHGDE 178

Query: 176 VVQDFIKNITANE 188
               ++K + AN+
Sbjct: 179 KTLAWLKAMKANQ 191


>gi|219849292|ref|YP_002463725.1| extracellular solute-binding protein family 1 protein [Chloroflexus
           aggregans DSM 9485]
 gi|219543551|gb|ACL25289.1| extracellular solute-binding protein family 1 [Chloroflexus
           aggregans DSM 9485]
          Length = 349

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 47/205 (22%), Positives = 94/205 (45%), Gaps = 16/205 (7%)

Query: 6   IYTYLLLLCG---------FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS 56
           I   ++  CG            A +   T   L +Y+ +++S++ P    F E TG+ + 
Sbjct: 12  IAALMIAACGNQTASTPTQAPAAPTPTQTLAKLVVYSGRSESLVGPFFTRFTEATGIPVE 71

Query: 57  PIYTSSIQRPP--ITQG--SPVDVIITKDETSLALNED--LLHKLPAHLIKKNSFVLKNE 110
             Y  + +     + +G  SP D+   +D  +L       +L  L   ++ +     ++ 
Sbjct: 72  VRYGDTAELAATILEEGANSPADLFFAQDAGALGALAAADVLIPLSTDILNQVEARFRSS 131

Query: 111 NKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQ 170
           + + + IS   +V+ Y+T ++  ADLP+S+    + QW+ R+  AP N SF   +  M  
Sbjct: 132 DGRWVGISGRARVVVYNTNKLTEADLPRSITGFVDPQWRGRVGWAPTNGSFQAFITAMRV 191

Query: 171 TPNKTVVQDFIKNITANEILTKYKR 195
              +   + +++ + ANE+ T Y+R
Sbjct: 192 QLGEEATRKWLEGMIANEVKT-YER 215


>gi|310830323|ref|YP_003965423.1| ferric iron ABC transporter iron-binding protein
           [Ketogulonicigenium vulgare Y25]
 gi|308753229|gb|ADO44372.1| ferric iron ABC transporter iron-binding protein
           [Ketogulonicigenium vulgare Y25]
          Length = 331

 Score =  222 bits (567), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 89/191 (46%), Gaps = 5/191 (2%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K      +    GF    +T  + + LT+Y+ + ++++ P++  FE  TG+     Y S
Sbjct: 1   MKNAYLAGVAFALGFAS-VATMASAQSLTIYSGRGEALIGPLVAQFEAETGIDAEVRYGS 59

Query: 62  SIQRPPI----TQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           + +   +     + +P D+   +D  +L         L A + +    V ++ + K +  
Sbjct: 60  TAEMAALLMEEGENTPADLFWAQDAGALGALAPHFSDLAAGVNETVLPVFRDPSNKWVAT 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           S  T+VL YST R++   LP ++ DLT+  ++ R++ AP N SF   +     T      
Sbjct: 120 SGRTRVLVYSTDRVEEGALPAAITDLTDEAYRGRVAWAPTNGSFQAFVTAFRLTHGDDAA 179

Query: 178 QDFIKNITANE 188
           + +++ + ANE
Sbjct: 180 KAWLEGMIANE 190


>gi|158317096|ref|YP_001509604.1| extracellular solute-binding protein [Frankia sp. EAN1pec]
 gi|158112501|gb|ABW14698.1| extracellular solute-binding protein family 1 [Frankia sp. EAN1pec]
          Length = 358

 Score =  220 bits (562), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 79/196 (40%), Gaps = 7/196 (3%)

Query: 3   KRTIYT-YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           +R +      +L G   A    +  K LTLY  Q++ +M  ++ +F + TG+K+      
Sbjct: 26  RRALAVLATAILVGGLSAACGGDDGKTLTLYNAQHRDLMQVLVDAFTKETGIKVEMRNGG 85

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLM 115
             +     + +G  SP D+  T++  ++ L         L    + +        +   +
Sbjct: 86  DAELANQIVQEGDSSPADLFATENSPAMTLVDRAGGFSPLDQATLDQMPDQYVPSSGTWV 145

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
             +  + V  Y+  ++    LP S+ DL   +W+ R+ +A     F  +++ +     + 
Sbjct: 146 GFAARSTVFIYNRDQVDKDALPTSIMDLARPEWQGRVGVAAGGADFQAIVSAVLAVEGED 205

Query: 176 VVQDFIKNITANEILT 191
              D++  +  N  + 
Sbjct: 206 AAADWLAGLKRNAKIY 221


>gi|86740297|ref|YP_480697.1| extracellular solute-binding protein [Frankia sp. CcI3]
 gi|86567159|gb|ABD10968.1| extracellular solute-binding protein, family 1 [Frankia sp. CcI3]
          Length = 354

 Score =  220 bits (561), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 81/197 (41%), Gaps = 7/197 (3%)

Query: 2   FKRTIYTYLLLLC-GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
             RT+   +   C     A  + +  K +TLY  Q+Q +M  ++ +F ++TG+K+     
Sbjct: 21  LGRTLVVLVTATCLAGLSACGSGDDGKTITLYNAQHQDLMRVMVDAFTKQTGIKVELRRG 80

Query: 61  SS--IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
               +    + +G  SP DV +T++  ++ L        KL    + +            
Sbjct: 81  GDPELANQIVQEGDSSPADVFVTENSPAMTLVDRAGRFSKLDRATLGQVPDQYVPSTGNW 140

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           +  +  + V  Y+  ++   +LP S+ DL    WK ++ +A     F  +++ +     +
Sbjct: 141 VGFAARSTVFIYNRGQVAKNELPTSIMDLAGPAWKGKVGVAAAGADFQAIVSAVLAVKGE 200

Query: 175 TVVQDFIKNITANEILT 191
               +++  +  N  + 
Sbjct: 201 GATAEWLAGLKRNAKIY 217


>gi|88855885|ref|ZP_01130547.1| iron(III) ABC transporter, periplasmic-binding protein [marine
           actinobacterium PHSC20C1]
 gi|88814752|gb|EAR24612.1| iron(III) ABC transporter, periplasmic-binding protein [marine
           actinobacterium PHSC20C1]
          Length = 340

 Score =  218 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 77/184 (41%), Gaps = 8/184 (4%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--S 72
            +      + + L +Y  Q++ +    +  F  +TG+++        +     + +G  S
Sbjct: 23  DDGAVEGASAEALVVYNAQHEKLAEEWVEEFTAQTGIEVVLRNGGDSELSNQLVAEGDAS 82

Query: 73  PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
             DV +T++  +++L  N  L   +    +       +  +     I+  + V  Y+ + 
Sbjct: 83  RADVFLTENSPAMSLVENAGLFAPVDPATLDLVPEKYRPASGMWTGIAARSAVFVYNPEL 142

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           +  ++LP S+ DL +  WK +   AP+   F  +++ + +T       +++  +  N   
Sbjct: 143 LDESELPSSILDLQSPSWKGKWGGAPSGADFQAIISAILETQGPEATAEWLTGMKDN--A 200

Query: 191 TKYK 194
           T Y+
Sbjct: 201 TVYR 204


>gi|115372071|ref|ZP_01459383.1| bacterial extracellular solute-binding protein, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|310824710|ref|YP_003957068.1| iron ABC transporter periplasmic iron-binding protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115371036|gb|EAU69959.1| bacterial extracellular solute-binding protein, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|309397782|gb|ADO75241.1| Iron ABC transporter, periplasmic iron-binding protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 328

 Score =  217 bits (553), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 85/180 (47%), Gaps = 7/180 (3%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDV 76
           S  +  + LT+Y+ +N+ ++ P+  +F  +TG+++   Y  + Q     + +G  SP DV
Sbjct: 15  SAVHAAETLTVYSGRNERLVGPLYKAFTAKTGIEVKVRYGETPQLVATLMEEGAKSPADV 74

Query: 77  IITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
            + +D  +L       LL  LP   ++K     ++     + +S   +V+AY+T ++K  
Sbjct: 75  FVAQDAGALGALAKAQLLQPLPKAQVEKVDARFRSPEALWVGLSGRARVVAYNTAKVKPE 134

Query: 135 DLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
            LP  +   T   WK R+  AP N SF   +  +         + +++ + AN   T YK
Sbjct: 135 QLPTGIQGFTEPAWKGRIGWAPTNGSFQAFVTALRLMKGDAAAKKWLEGVKANAPRT-YK 193


>gi|209516403|ref|ZP_03265259.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           H160]
 gi|209503165|gb|EEA03165.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           H160]
          Length = 367

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 89/190 (46%), Gaps = 6/190 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS-- 61
           R + +   L         +      +TLY  Q++ V+  +   FE+++G+ +        
Sbjct: 35  RALGSVAALSLTALATMPSAAHAASITLYNAQHEQVVNLLAKDFEKQSGISVKIRNGEGP 94

Query: 62  SIQRPPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           ++    + +G  SP DV  T++   L L E   LL K+ A  +        + +   + +
Sbjct: 95  ALAAQIVAEGAASPADVYFTENSPELMLLEEKGLLAKVDAATLGTVPARFNSPSGVWVAV 154

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +    VLAY+T +++ + LP+SVFDL   +WK ++ IAP++  F  L++ +     +   
Sbjct: 155 TARESVLAYNTTKLQPSQLPQSVFDLAKPEWKGKVGIAPSDADFLPLVSAVLALKGEEQT 214

Query: 178 QDFIKNITAN 187
             ++K + AN
Sbjct: 215 LAWLKGLKAN 224


>gi|324997494|ref|ZP_08118606.1| ABC-type Fe3+ transport system, periplasmic component
           [Pseudonocardia sp. P1]
          Length = 999

 Score =  214 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 89/196 (45%), Gaps = 13/196 (6%)

Query: 6   IYTYLLLLCGFTEAFSTEN-------TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
             + L+  CG       E          + LTLY+ +++ ++ P+I  F++++G+ +   
Sbjct: 16  AVSLLVTACGGGAPAPAEPAASPAAEGPRTLTLYSGRDEELVAPLIQQFQQQSGITVDTR 75

Query: 59  YTSSIQRPPITQ----GSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENK 112
           Y S+ +     Q    G+P  V +++D  +L           LPA +         + + 
Sbjct: 76  YGSTTELAAQIQEEGDGTPAQVYLSQDAGALGVLAGAGRFAPLPADVAGAVPAGFTSTDG 135

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTP 172
             + ++   +V+AY ++ +  A+ P  V +LT+ +W+ R+  AP N SF   +  M  T 
Sbjct: 136 TWVGLTGRARVVAYDSQDVPEAEAPGDVRELTDPKWRGRVGYAPTNASFQAFVTAMRVTD 195

Query: 173 NKTVVQDFIKNITANE 188
            +   + ++  + ANE
Sbjct: 196 GEEATRQWLTALAANE 211


>gi|145223949|ref|YP_001134627.1| extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]
 gi|315444281|ref|YP_004077160.1| ABC-type Fe3+ transporter, periplasmic component [Mycobacterium sp.
           Spyr1]
 gi|145216435|gb|ABP45839.1| extracellular solute-binding protein, family 1 [Mycobacterium
           gilvum PYR-GCK]
 gi|315262584|gb|ADT99325.1| ABC-type Fe3+ transport system, periplasmic component
           [Mycobacterium sp. Spyr1]
          Length = 342

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 78/194 (40%), Gaps = 11/194 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F           CG   A         + +Y+ +++ ++ P+I  F   TG+++   Y 
Sbjct: 11  VFGAVAAVLAFSACGSQPAG---EDADKIVVYSGRSEELVKPLIEQFTTDTGIQVETRYA 67

Query: 61  SSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKL 114
            S +     +T+G  SP DV +++D  +L       L   + A  +          +   
Sbjct: 68  GSGELAAQLLTEGDKSPADVFLSQDAGALGAVSKAGLFAPINADALAAVPKQYSAADGTW 127

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
           + +S   +V+ Y+   +   D P ++  L   +WK ++  AP+N S+   +  +      
Sbjct: 128 LGVSGRARVIVYNPTLVP--DPPDTIDGLLAPEWKGKIGFAPSNASWQAFVTGLRVIRGD 185

Query: 175 TVVQDFIKNITANE 188
              + +++   A +
Sbjct: 186 DGAEQWLRAFKAQD 199


>gi|313680521|ref|YP_004058260.1| extracellular solute-binding protein family 1 [Oceanithermus
           profundus DSM 14977]
 gi|313153236|gb|ADR37087.1| extracellular solute-binding protein family 1 [Oceanithermus
           profundus DSM 14977]
          Length = 330

 Score =  213 bits (544), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 94/193 (48%), Gaps = 10/193 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
             R I   +LL+     A++ +     L +Y+ +++S++ P I  F++ TG+++   Y  
Sbjct: 1   MNRKIPFLMLLVVSSALAWAAQP----LVVYSGRSKSLVEPAIERFQQATGLRVRVKYGK 56

Query: 62  SI--QRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLM 115
           +       + +G  SP D+ + +D  +L+          LP  L+++     ++ + + +
Sbjct: 57  TAPLALLLLEEGDRSPADLFLAQDAGALSLLAEAGRFAPLPEALLERVPARFRDPDGRWI 116

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
            ++   + LAY+ +R    +LP SVFDLT  +++ R+ IAP N SF   +  M       
Sbjct: 117 GVTGRARTLAYAPERAAAGELPGSVFDLTAPRFQGRVGIAPTNASFQTFVTAMRAVHGDA 176

Query: 176 VVQDFIKNITANE 188
               +++++ AN 
Sbjct: 177 RTLAWLRDLKANG 189


>gi|312114161|ref|YP_004011757.1| extracellular solute-binding protein family 1 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219290|gb|ADP70658.1| extracellular solute-binding protein family 1 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 331

 Score =  213 bits (543), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 57/194 (29%), Positives = 93/194 (47%), Gaps = 6/194 (3%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            ++TI+   L +   T   +     + LT+Y+ + +S   PI   FEE+TG+KI   Y S
Sbjct: 1   MRKTIFAGALSI--ATIISAIAAQAQELTVYSGRGESFAGPIFKIFEEQTGIKIKARYGS 58

Query: 62  SIQRPPI--TQG--SPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           + +   +   +G  SP DV + +D  +L  N  L    P  L +      ++ + K +  
Sbjct: 59  TAELSALLKEEGAKSPADVFLAQDAGALIENRPLFADAPKALSETVLPQFRSNDSKWLAT 118

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           S   + LAYS +R+K   LPKS FDLT  +WK ++  +P N SF   L  +     +   
Sbjct: 119 SGRARTLAYSKERVKGDQLPKSAFDLTKPEWKGKVGYSPKNASFQAFLTALRVQEGEEKA 178

Query: 178 QDFIKNITANEILT 191
           + F+K +  N   T
Sbjct: 179 KAFVKGLVDNGAKT 192


>gi|294815767|ref|ZP_06774410.1| ABC-type Fe3+ transport system, periplasmic component [Streptomyces
           clavuligerus ATCC 27064]
 gi|294328366|gb|EFG10009.1| ABC-type Fe3+ transport system, periplasmic component [Streptomyces
           clavuligerus ATCC 27064]
          Length = 378

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 78/184 (42%), Gaps = 8/184 (4%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG- 71
           G       +   + L +Y+ +N+ ++ PII   E+ TG  +   Y  S +     + +G 
Sbjct: 60  GKETEAGEQKGAEKLVIYSGRNEELISPIIGKLEKATGTDVEVRYGDSAELAAQILEEGD 119

Query: 72  -SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            +   +  ++D  +L        L KLP   + K     +   +  + +S  ++V+AY+ 
Sbjct: 120 RTKAGLFFSQDAGALGALSQAGQLAKLPQKSLDKVDAAFRGGEQDWVGVSGRSRVIAYNP 179

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           K      +P S+ DLT  +WK ++  AP N SF   +  M     +     ++K + AN 
Sbjct: 180 K--SAGKVPDSIHDLTAPKWKGKVGYAPTNASFQAFVTGMRVLEGEDATLKWLKGLKANG 237

Query: 189 ILTK 192
               
Sbjct: 238 KTYA 241


>gi|108759415|ref|YP_629036.1| iron ABC transporter periplasmic iron-binding protein [Myxococcus
           xanthus DK 1622]
 gi|108463295|gb|ABF88480.1| iron ABC transporter, periplasmic iron-binding protein [Myxococcus
           xanthus DK 1622]
          Length = 327

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 83/175 (47%), Gaps = 6/175 (3%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVD 75
            S     + LT+Y+ +N+ ++ P++  F E+TGV++   Y  + Q     + +G  +P D
Sbjct: 14  ASPALAAETLTIYSGRNEKLVGPLLKKFTEKTGVEVKVRYGETPQLAATLLEEGAKTPAD 73

Query: 76  VIITKDETSLALNEDL--LHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           V   +D  +L        L  LP   + K     ++     +  S   +V+AY+TK++K 
Sbjct: 74  VFFAQDAGALGALAKAGQLQVLPKETLDKVDARFRSPQGVWVGTSGRARVVAYNTKKVKA 133

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
             LPKS+   T+A+WK RL  AP N SF   +  +           ++K + AN 
Sbjct: 134 DTLPKSILGFTDAKWKGRLGWAPTNASFQSFVTALRLLKGDEAATQWLKGVQANA 188


>gi|325528370|gb|EGD05516.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. TJI49]
          Length = 335

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 85/190 (44%), Gaps = 8/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--S 62
           +     L+L G   A      T  LTLY  Q++ V+  ++  FE ++G+ +        +
Sbjct: 6   SAAAAALMLTGALTAMPARAAT--LTLYNAQHEQVVNQLVKDFEAQSGITVKVRSGEGPA 63

Query: 63  IQRPPITQG--SPVDVIITKDETSLALN--EDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
           +    +T+G  +P DV  T++   L L   + LL K  A  ++         +   + + 
Sbjct: 64  LAAQLVTEGDRTPADVYFTENSPELVLLDHKGLLAKTDAATLQAVPARYNPADGNWVGVL 123

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
               VL Y+T +++   LP S+ DL   +WK ++ IAP++  F  +++ +     +    
Sbjct: 124 ARENVLVYNTAKLQPQQLPASLLDLAKPEWKGKVGIAPSDADFLPVVSAVLALHGEAATL 183

Query: 179 DFIKNITANE 188
            ++K +  N 
Sbjct: 184 QWLKGLKTNA 193


>gi|326444113|ref|ZP_08218847.1| iron ABC transporter periplasmic iron-binding protein [Streptomyces
           clavuligerus ATCC 27064]
          Length = 352

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 78/184 (42%), Gaps = 8/184 (4%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG- 71
           G       +   + L +Y+ +N+ ++ PII   E+ TG  +   Y  S +     + +G 
Sbjct: 34  GKETEAGEQKGAEKLVIYSGRNEELISPIIGKLEKATGTDVEVRYGDSAELAAQILEEGD 93

Query: 72  -SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            +   +  ++D  +L        L KLP   + K     +   +  + +S  ++V+AY+ 
Sbjct: 94  RTKAGLFFSQDAGALGALSQAGQLAKLPQKSLDKVDAAFRGGEQDWVGVSGRSRVIAYNP 153

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           K      +P S+ DLT  +WK ++  AP N SF   +  M     +     ++K + AN 
Sbjct: 154 K--SAGKVPDSIHDLTAPKWKGKVGYAPTNASFQAFVTGMRVLEGEDATLKWLKGLKANG 211

Query: 189 ILTK 192
               
Sbjct: 212 KTYA 215


>gi|289642374|ref|ZP_06474521.1| extracellular solute-binding protein family 1 [Frankia symbiont of
           Datisca glomerata]
 gi|289507806|gb|EFD28758.1| extracellular solute-binding protein family 1 [Frankia symbiont of
           Datisca glomerata]
          Length = 339

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 80/199 (40%), Gaps = 6/199 (3%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-- 60
           +       ++L     A         +TLY  Q++ ++  ++  F   TG+K++      
Sbjct: 8   RIATLAMGVVLTAAATACGGSEDASTITLYNAQHEDLIKVMVDGFTRETGIKVNIRSGKD 67

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
           S +    + +G  SP DV +T++  +++L        K+    + +        ++    
Sbjct: 68  SELANQLVQEGDASPADVFVTENSPAMSLVDAHGRFVKIDDATLAQVPAQFVPSSRNWTG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
            +    VLAY+ +++    LP S+ DL   QW+ +  +A     F  +++ +  +  +  
Sbjct: 128 FAARATVLAYNKRQLAPDQLPASLMDLQQPQWQGKFGVAAAGADFQAIVSAVLVSKGEVA 187

Query: 177 VQDFIKNITANEILTKYKR 195
              ++  +  N  +    R
Sbjct: 188 TGTWLAALKTNAKIYANNR 206


>gi|296160752|ref|ZP_06843566.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           Ch1-1]
 gi|295889055|gb|EFG68859.1| extracellular solute-binding protein family 1 [Burkholderia sp.
           Ch1-1]
          Length = 343

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 90/191 (47%), Gaps = 6/191 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS-- 61
           R + +   L+        +      +TLY  Q++ V+  +   FE+++G+ +        
Sbjct: 11  RVLGSVAALMLAAFATMPSAAQAASITLYNAQHEQVVNLLARDFEKQSGISVKIRNGEGP 70

Query: 62  SIQRPPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           ++    + +G  +P DV  T++   L L E   LL K+ +  +        + +   + +
Sbjct: 71  AMAAQIVAEGAATPADVYFTENSPELMLLEEKGLLSKVDSSTLATVPARFSSPSGAWVAV 130

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +    VLAY+T +++ A LP+S+FDL   +WK ++ IAP++  F  L++ +     +   
Sbjct: 131 TARENVLAYNTTKVQAAQLPQSLFDLARPEWKGKIGIAPSDGDFLPLVSAVLALKGEAQT 190

Query: 178 QDFIKNITANE 188
             ++K + AN 
Sbjct: 191 VQWLKGLKANA 201


>gi|221635940|ref|YP_002523816.1| extracellular solute-binding protein, family 1 [Thermomicrobium
           roseum DSM 5159]
 gi|221157680|gb|ACM06798.1| extracellular solute-binding protein, family 1 [Thermomicrobium
           roseum DSM 5159]
          Length = 382

 Score =  210 bits (536), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 86/172 (50%), Gaps = 7/172 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQG--SPVDVI 77
           T + +  +T+Y+ +++S++ P++    +  G+ +   Y  + +     + +G  SP D+ 
Sbjct: 69  TRSQSAVVTIYSGRSKSLIGPLLDRIGQELGLDVRVRYGDTAELATAILEEGDRSPADLF 128

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
             +D  +L     E  L  LP+ L+++     ++     + IS   + + Y+T+R+K  +
Sbjct: 129 FGQDAGALGALAKEGRLAPLPSELLQRVPQPYRSPKGLWVGISGRVRTVIYNTERVKPEE 188

Query: 136 LPKSVFDLT-NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           +P S+ D   N +W+ RL  AP N SF   +  + +   + V + +++ + A
Sbjct: 189 IPASIVDFAGNERWRARLGWAPTNGSFQAFVTALRRLRGEDVARSWLQGVKA 240


>gi|187919532|ref|YP_001888563.1| family 1 extracellular solute-binding protein [Burkholderia
           phytofirmans PsJN]
 gi|187717970|gb|ACD19193.1| extracellular solute-binding protein family 1 [Burkholderia
           phytofirmans PsJN]
          Length = 347

 Score =  210 bits (535), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 91/195 (46%), Gaps = 10/195 (5%)

Query: 4   RTIYTYLLLLCGFTEAF----STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
           R + T L      T A      +      +TLY  Q++ V+  +   FE+++G+ +    
Sbjct: 11  RAVATSLGSAVALTLAAFATVPSAAEAASITLYNAQHEQVVNLLAKDFEKQSGISVKIRN 70

Query: 60  TS--SIQRPPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKK 113
               ++    + +G  +P DV  T++   L L E   LL+K+ A  +        +    
Sbjct: 71  GEGPAMAAQIVAEGAATPADVYFTENSPELMLLEEKGLLNKVDASTLATVPARFNSPTGA 130

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
            + ++    VLAY+T +++ + LP+S+FDL   +WK ++ IAP++  F  L++ +     
Sbjct: 131 WVAVTARENVLAYNTTKVQASQLPQSLFDLAKPEWKGKIGIAPSDGDFLPLVSAVLALKG 190

Query: 174 KTVVQDFIKNITANE 188
           +     ++K + AN 
Sbjct: 191 EAQTVQWLKGLKANA 205


>gi|284992052|ref|YP_003410606.1| family 1 extracellular solute-binding protein [Geodermatophilus
           obscurus DSM 43160]
 gi|284065297|gb|ADB76235.1| extracellular solute-binding protein family 1 [Geodermatophilus
           obscurus DSM 43160]
          Length = 343

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 78/175 (44%), Gaps = 6/175 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQG--SPVDVIIT 79
              + LT+Y+ Q++S++  ++  F E TG+ +       + +    + +G  SP DV +T
Sbjct: 33  EAAETLTVYSAQHESLVRTMLEGFTEETGIALEFRDANDAELANQIVQEGEASPADVFLT 92

Query: 80  KDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           ++  S+ +   E LL  L    + +     +  +      +  + VL ++  ++    LP
Sbjct: 93  ENSPSIDVLDREGLLAPLDQSTLDQVGAQYRPSSGNWTGFAARSTVLVHNPAQLPQDQLP 152

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            S+ DL N +W+ R+ IA     F  ++  +     +   + +++ +  N  +  
Sbjct: 153 ASILDLANPEWQGRIGIAAGGADFQAIVAGVLALRGEEATRAWLEGLERNANVYP 207


>gi|78065424|ref|YP_368193.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. 383]
 gi|77966169|gb|ABB07549.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia sp. 383]
          Length = 344

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 82/190 (43%), Gaps = 8/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--S 62
           +     L+L G   A      T  L  Y  Q++ V+  ++  FE ++G+ +        +
Sbjct: 15  SAAAAALMLTGALHAARAHAATLTL--YNAQHEQVVNQLVKDFEAQSGITVKVRSGEGPA 72

Query: 63  IQRPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
           +    + +G  +P DV  T++   L L   + L  K  A  ++         +   + + 
Sbjct: 73  LAAQLVAEGDRTPADVYFTENSPELVLLDRKGLFAKTDAATLQSVPARFNPADGNWVGVL 132

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
               VL Y+T +I+   LP S+ DL   +WK ++ +AP++  F  L++ +     +    
Sbjct: 133 ARENVLVYNTAKIQPQQLPASLLDLAKPEWKGKVGVAPSDADFLPLVSAVLALHGEAATL 192

Query: 179 DFIKNITANE 188
            ++K + AN 
Sbjct: 193 QWLKGLKANA 202


>gi|120404072|ref|YP_953901.1| extracellular solute-binding protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956890|gb|ABM13895.1| extracellular solute-binding protein, family 1 [Mycobacterium
           vanbaalenii PYR-1]
          Length = 340

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            + T +L L        +E+  K + +Y  ++++++ P+I  F   TG+++   Y  S +
Sbjct: 11  AVITAMLALTACGSGSQSEDADK-IVVYAGRSEALIAPLIEQFTADTGIEVEARYAGSGE 69

Query: 65  RPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
                IT+G  SP DV +++D  +L       L   +    +          +   + +S
Sbjct: 70  LAAQLITEGDKSPADVFLSQDAGALGAVSKAGLFAPISPDTLAAVPAQYSAADGTWVGVS 129

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
              +V+ Y+       + P ++  L   +WK ++  AP+N S+   +  +         +
Sbjct: 130 GRARVIVYNPTLAP--NPPDTIDGLLAPEWKGKIGFAPSNASWQAFVTGLRVLRGDDGAE 187

Query: 179 DFIKNITANE 188
            +++     +
Sbjct: 188 RWLRAFKDQD 197


>gi|262199751|ref|YP_003270960.1| extracellular solute-binding protein family 1 [Haliangium ochraceum
           DSM 14365]
 gi|262083098|gb|ACY19067.1| extracellular solute-binding protein family 1 [Haliangium ochraceum
           DSM 14365]
          Length = 356

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 49/178 (27%), Positives = 89/178 (50%), Gaps = 6/178 (3%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI----TQGS 72
           T           LT+Y+ +++ ++ P + +FE+ +GV +   Y  + +         + S
Sbjct: 38  TAQAEAPAEVSTLTVYSGRSEKLVAPALQAFEQLSGVDLEIKYGDTAELAAALLDEGENS 97

Query: 73  PVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKR 130
           P DV I +D +SLA   ++DL   LP  +  + +   + ++   + ++   +VLAY+T +
Sbjct: 98  PADVFIAQDASSLAFLASKDLFAPLPDDIGGRVAETFRADDASWVGLTGRARVLAYNTDK 157

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           +K  DLPKS  +L +  WK R+  AP N SF   +  M Q       Q +++ + ANE
Sbjct: 158 LKPEDLPKSAAELGDPVWKGRVGWAPENASFQSAVAAMVQLEGAEATQTWLEAVKANE 215


>gi|319949480|ref|ZP_08023536.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Dietzia
           cinnamea P4]
 gi|319436851|gb|EFV91915.1| ABC Fe(3+) transporter, substrate binding protein SfuA [Dietzia
           cinnamea P4]
          Length = 327

 Score =  208 bits (529), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 78/186 (41%), Gaps = 7/186 (3%)

Query: 16  FTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG-- 71
              A   ++    + +Y  Q++S+   +  +F   TG+++     S   +    + +G  
Sbjct: 7   SMSACGLDSGDDAVIVYNAQHESLTRELADAFTRETGIEVELRNGSDFDLGNQLVAEGDA 66

Query: 72  SPVDVIITKDETS--LALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           S  DV +T++  +  +   E LL  +    + +     +      + I+  + V  Y+T 
Sbjct: 67  SRADVYLTENSPAISMVAREGLLAPVADETVGQVPPEYRPSTGDWVGIAARSTVFVYNTT 126

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA-NE 188
            +   +LP S  DL++ +W  R   AP    F  +++   +   +   + +++++   + 
Sbjct: 127 AVTEDELPTSFSDLSSPRWAGRWGAAPAGADFQAIVSAALEMSGEQETRRWLESLRRPDG 186

Query: 189 ILTKYK 194
             + YK
Sbjct: 187 GFSTYK 192


>gi|218296266|ref|ZP_03497022.1| extracellular solute-binding protein family 1 [Thermus aquaticus
           Y51MC23]
 gi|218243338|gb|EED09868.1| extracellular solute-binding protein family 1 [Thermus aquaticus
           Y51MC23]
          Length = 331

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 15/196 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M +RTI T    L G T    +   T+ LT+Y+ + QS++ P++  FE  TG+++   Y 
Sbjct: 1   MERRTILT----LIGLTILNLSLAQTQTLTVYSGRGQSLVEPLVKQFERDTGIRVQVRYG 56

Query: 61  SSIQR--PPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKL 114
           +  Q       +G  SP DV       +L       LL  L   L+K         ++  
Sbjct: 57  TDAQILAALQEEGGRSPADVFWGNTSGALGRAAELGLLRPLGDSLLKT-PQAFAPASRSW 115

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWK----KRLSIAPNNISFHRLLNTMEQ 170
           + ++   +VLAY+ ++ K  +LP+S+ DL     +     R+   P   SF  ++  M  
Sbjct: 116 VPVTLRLRVLAYNPQKFKPEELPQSILDLPRFAREKGLGGRVGWTPTYSSFQDMVAGMIA 175

Query: 171 TPNKTVVQDFIKNITA 186
              +   + +++ + A
Sbjct: 176 LHGEAKTRAWLEEMKA 191


>gi|311742443|ref|ZP_07716252.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Aeromicrobium marinum DSM 15272]
 gi|311314071|gb|EFQ83979.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Aeromicrobium marinum DSM 15272]
          Length = 341

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 79/181 (43%), Gaps = 6/181 (3%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG- 71
                     +   L +Y  +++ ++ P+I  F E TG+++   Y  + +     I +G 
Sbjct: 24  ACGSDPDDTASGDALVVYVGRDEELVSPLIEQFTEETGIQVEARYAGTTEHAATLIDEGD 83

Query: 72  -SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            +P DV +++D  +L    +E LL +LPA +         + +   + I+   +V+AY  
Sbjct: 84  RTPADVFLSQDAGALGALADEGLLRELPADITGAVLPEFTSTDGSWVGITGRARVIAYDG 143

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           + +   ++P +V      +W  R+   P N SF   +            + +++ + +N+
Sbjct: 144 EELSADEVPGTVATFAEPEWSGRVGFPPGNASFQAFVTAYRVAEGDDAARAWLEGMESND 203

Query: 189 I 189
           +
Sbjct: 204 L 204


>gi|91778275|ref|YP_553483.1| ABC Fe+3 transporter, periplasmic ligand binding protein
           [Burkholderia xenovorans LB400]
 gi|91690935|gb|ABE34133.1| ABC Fe+3 transporter, periplasmic ligand binding protein
           [Burkholderia xenovorans LB400]
          Length = 343

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 88/191 (46%), Gaps = 6/191 (3%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS-- 61
           R + +   L         +      +TLY  Q++ V+  +   FE+++G+ +        
Sbjct: 11  RVLGSAAALALTAFATAPSAAQAASITLYNAQHEQVVNLLAKDFEKQSGISVKIRNGEGP 70

Query: 62  SIQRPPITQG--SPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           ++    + +G  +P DV  T++   L L E   LL K+ A  +        +     + +
Sbjct: 71  AMAAQIVAEGAATPADVYFTENSPELMLLEEKGLLSKVDASTLATVPARFSSPTGAWVAV 130

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVV 177
           +    VLAY+T +++ + LP+S+FDL   +WK ++ IAP++  F  L++ +     +   
Sbjct: 131 TARENVLAYNTAKVQASQLPQSLFDLARPEWKGKIGIAPSDGDFLPLVSAVLALKGEAQT 190

Query: 178 QDFIKNITANE 188
             ++K + AN 
Sbjct: 191 VQWLKGLKANA 201


>gi|118473479|ref|YP_887939.1| ferric iron-binding periplasmic protein of ABC transporter
           [Mycobacterium smegmatis str. MC2 155]
 gi|118174766|gb|ABK75662.1| ferric iron-binding periplasmic protein of ABC transporter
           [Mycobacterium smegmatis str. MC2 155]
          Length = 349

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 77/186 (41%), Gaps = 9/186 (4%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG- 71
                    ++   + +Y+ ++++++ P+I  F   TG+++   Y  S +     IT+G 
Sbjct: 29  ACGSGSDEADSADKIVVYSGRSENLVAPLIEKFTSDTGIEVETRYAGSGELAAQLITEGD 88

Query: 72  -SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST 128
            SP DV +++D  +L       L   +    +          +K  + +S   +VL Y+ 
Sbjct: 89  KSPADVFLSQDAGALGAVSEAGLFAPINDEAMAAVPANFSAADKSWLGVSGRARVLVYNP 148

Query: 129 KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
                 + P ++  L   +WK ++  AP+N S+   +  +         + +++   A +
Sbjct: 149 DIAP--NPPDTIDGLLAPEWKGKIGFAPSNASWQSFVTGLRVIRGDDGARQWLEAFKAQD 206

Query: 189 ILTKYK 194
               Y+
Sbjct: 207 P-QPYE 211


>gi|77456759|ref|YP_346264.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77380762|gb|ABA72275.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 336

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 86/195 (44%), Gaps = 9/195 (4%)

Query: 1   MFKRTI---YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISP 57
           MF+ T+    T+ LL        +       LTLY  Q++ V   I  +FE +TG+ ++ 
Sbjct: 2   MFRNTLRRGLTFTLLGLALAPPLTQAADAVSLTLYNGQHKEVGDAIAKAFEAKTGIHVNV 61

Query: 58  IYTSSIQR--PPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNEN 111
              SS Q     I +G  SP DVI T++   L     + LL K     +          N
Sbjct: 62  RKGSSNQLASQIIEEGDRSPADVIYTEESPPLNNLGEQGLLAKADDATLAVLPKEYVAGN 121

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQT 171
              + ++   +V+A++ K I   DLPKSV D  + QW+ ++   P + +F      + + 
Sbjct: 122 GTWIGVTARVRVVAFNPKLIDEKDLPKSVLDFADPQWQGKVGFVPTSGAFQEQAVAIIKK 181

Query: 172 PNKTVVQDFIKNITA 186
             +   ++++  + A
Sbjct: 182 HGREAAEEWLTGLRA 196


>gi|317125279|ref|YP_004099391.1| extracellular solute-binding protein family 1 [Intrasporangium
           calvum DSM 43043]
 gi|315589367|gb|ADU48664.1| extracellular solute-binding protein family 1 [Intrasporangium
           calvum DSM 43043]
          Length = 342

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 78/181 (43%), Gaps = 7/181 (3%)

Query: 14  CGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG 71
           CG      T      L +Y+ +++S++  I+      TGVK+   Y  S +     + +G
Sbjct: 22  CGSDGPADTTEGAD-LVIYSGRSESLVKGILDDLAAETGVKVGVRYAGSSELAAQLLEEG 80

Query: 72  --SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
             +  DV  ++D  +L     E  L  L A +  +      + +   +  S   +V+AY+
Sbjct: 81  DATKADVFFSQDAGALGALAKEGRLEPLDAAVTDRVIAGFADPDGHWVGTSARARVIAYN 140

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            ++    +   SV  + + ++K ++  AP N SFH  +  +     +   ++++    AN
Sbjct: 141 PQQAPEVEQMTSVDAVLDPKYKGKIGYAPANASFHAFVTALRVAKGEDGAREWLTKFKAN 200

Query: 188 E 188
           E
Sbjct: 201 E 201


>gi|258651887|ref|YP_003201043.1| family 1 extracellular solute-binding protein [Nakamurella
           multipartita DSM 44233]
 gi|258555112|gb|ACV78054.1| extracellular solute-binding protein family 1 [Nakamurella
           multipartita DSM 44233]
          Length = 366

 Score =  203 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 75/179 (41%), Gaps = 9/179 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPPITQG--SPVDVII 78
             T   L +Y+ +N+ ++ P++  F  +TGV +         +    +T+G  SP DV  
Sbjct: 54  SETGGTLVVYSGRNKDLIGPLLDQFSAQTGVAVEFRAGDSGELAAQLLTEGDASPADVFF 113

Query: 79  TKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
           ++D  +L       L   LPA  ++         +   + +S   +V+ Y+       + 
Sbjct: 114 SQDAGALGAVAQAGLFTSLPAATVEAVPAAYAATDGSWVGVSGRARVIVYNPTLAP--NP 171

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYKR 195
           P ++  L + QWK ++  AP N S+   +  +     +   + ++    A E    Y+R
Sbjct: 172 PDTIDGLLDPQWKGQIGFAPTNASWQAFVTGLRVLRGEDGARQWLTAFAAQEPK-AYER 229


>gi|229588083|ref|YP_002870202.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           SBW25]
 gi|229359949|emb|CAY46803.1| putative iron-binding periplasmic protein [Pseudomonas fluorescens
           SBW25]
          Length = 341

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 42/175 (24%), Positives = 79/175 (45%), Gaps = 6/175 (3%)

Query: 18  EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SP 73
              +       LTLY  Q++ V   +  +FE +TG+ ++    SS Q     + +G  SP
Sbjct: 27  SPTAYSADKVSLTLYNGQHKEVGDELAKAFEAKTGIHVNVRKGSSNQLASQVVEEGDRSP 86

Query: 74  VDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
            DVI T++   L     + LL K+ A  +          +   M ++  T+V+A++ K I
Sbjct: 87  ADVIYTEESPPLNKLGEQGLLAKIDASTLDVLPKDYVGAHGDWMGVTARTRVVAFNPKLI 146

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
              DLPKSV D    +W+ ++   P + +F      + +   +   ++++  + A
Sbjct: 147 AEKDLPKSVLDFAGPEWQGKVGFVPTSGAFQEQAVAIIKLHGREAAEEWLTGLRA 201


>gi|291296393|ref|YP_003507791.1| extracellular solute-binding protein family 1 [Meiothermus ruber
           DSM 1279]
 gi|290471352|gb|ADD28771.1| extracellular solute-binding protein family 1 [Meiothermus ruber
           DSM 1279]
          Length = 328

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 51/193 (26%), Positives = 88/193 (45%), Gaps = 13/193 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           K  + T LL + G  +A       + LT+YT + Q ++ P++  FE  TG+K++  Y   
Sbjct: 4   KAVLVTTLLAVLGLAQA-----QQQSLTVYTGRGQGLVEPLVRQFEAETGIKVNVRYGRD 58

Query: 63  IQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
            +       +G  SP DV       +L +     LL +L    I +        +++ + 
Sbjct: 59  AEILAALQEEGSRSPADVFWANTAGALGVASERGLLVRLG-DTITRTPAYFVPASRQWVP 117

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKT 175
           ++   +VLAY   R+K  DLPKS+ DL    Q+K R+   P   SF  ++  M     + 
Sbjct: 118 LTVRLRVLAYDPSRVKPEDLPKSIMDLPKLTQYKGRIGWTPTYSSFQDMIAAMVAQYGEA 177

Query: 176 VVQDFIKNITANE 188
             + +I ++ A E
Sbjct: 178 RTRQWIADMKALE 190


>gi|296139778|ref|YP_003647021.1| extracellular solute-binding protein family 1 [Tsukamurella
           paurometabola DSM 20162]
 gi|296027912|gb|ADG78682.1| extracellular solute-binding protein family 1 [Tsukamurella
           paurometabola DSM 20162]
          Length = 345

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 79/187 (42%), Gaps = 12/187 (6%)

Query: 11  LLLCGFTEA-----FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           L  CG          S  +    +TLY+ +++ ++ P+I   +    V ++  Y      
Sbjct: 21  LTACGSGSTPDAGTSSASSAGPTITLYSGRSKELVGPLIDQIKGA--VSVNVAYDKK-AN 77

Query: 66  PPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
               +GS  P DV   +D   L       LL  LP+ ++ K     ++ +      S  +
Sbjct: 78  QIQEEGSRSPADVYFGQDAGELGALAKAGLLEPLPSDIVDKIPAQYRSGDGTWAATSARS 137

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
           +VL Y+  ++  ADLP  +  L + ++K ++  AP N SF   +  +     +   + ++
Sbjct: 138 RVLVYNPAQLPEADLPTGIDGLLDPKFKGKVGYAPTNASFKSFVTALRVLRGEDGAKAWL 197

Query: 182 KNITANE 188
           +   ANE
Sbjct: 198 QGFLANE 204


>gi|226356914|ref|YP_002786654.1| ABC transporter periplasmic protein [Deinococcus deserti VCD115]
 gi|226318904|gb|ACO46900.1| putative ABC transporter, periplasmic component [Deinococcus
           deserti VCD115]
          Length = 332

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 83/190 (43%), Gaps = 10/190 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           RT+     LL   T    T+     LT+Y+ + ++ + PI+  FE +TG+K++  Y +  
Sbjct: 3   RTVTALTALLVAGTSFAQTKG---TLTIYSGRAKTFVEPIVQQFERQTGIKVNVRYGTDA 59

Query: 64  QRPPI--TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRI 117
           Q       +G  SP D+       +L    +E    KL   L +  S     +++  +  
Sbjct: 60  QLVAALREEGNRSPADIYWGNSVGALGELASEGRFSKLGTALTRTVSDDYLPDDRSWLPT 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           +   +VLAY+T +IK   LP SV DL      K R+    +  SF   L  M     +  
Sbjct: 120 TVRFRVLAYNTSKIKPDQLPDSVLDLPKMTSLKGRIGWTVSYPSFQDFLAAMIAKHGEAT 179

Query: 177 VQDFIKNITA 186
            + +I+ + A
Sbjct: 180 TRQWIEGMKA 189


>gi|297567102|ref|YP_003686074.1| family 1 extracellular solute-binding protein [Meiothermus silvanus
           DSM 9946]
 gi|296851551|gb|ADH64566.1| extracellular solute-binding protein family 1 [Meiothermus silvanus
           DSM 9946]
          Length = 353

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 8/182 (4%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPIT 69
           +L     A       + LTLYT ++Q+++  ++  F++ TG+K++  Y    +       
Sbjct: 7   VLLASALALGVAQAQQSLTLYTGRSQALVDKLVQQFQKDTGIKVNVRYGRDAEILAALQE 66

Query: 70  QGS--PVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLA 125
           +GS  P DV       +L  A+  +LL +LPA L ++        + + + +S   +V A
Sbjct: 67  EGSRSPADVFWANTSGALEEAVKRNLLVQLPASLTRQ-PQEFVPSHGRWVPVSVRFRVAA 125

Query: 126 YSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
           Y+  ++K +D P SV DL   A++K R+   P   SF   +  M     +   + +++ +
Sbjct: 126 YNPTKVKDSDFPASVMDLPKVAKFKGRIGWTPTYSSFQDFITAMRVVKGEAATKAWLQAM 185

Query: 185 TA 186
            A
Sbjct: 186 IA 187


>gi|254244411|ref|ZP_04937733.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 2192]
 gi|126197789|gb|EAZ61852.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 2192]
          Length = 335

 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--P 66
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  AALACLLGSLSLNAAADPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 67  PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV+ T++   L    +  LL KL    +          N   + I+  T+
Sbjct: 72  ITEEGARSPADVLYTEESPPLIRLASAGLLAKLEPETLALVEPEHAGGNGDWVGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPTWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|107099639|ref|ZP_01363557.1| hypothetical protein PaerPA_01000655 [Pseudomonas aeruginosa PACS2]
          Length = 335

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--P 66
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  AALACLLGSLSLNAAAGPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 67  PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV+ T++   L    +  LL KL    +          N   + I+  T+
Sbjct: 72  ITEEGARSPADVLYTEESPPLIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|15599882|ref|NP_253376.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAO1]
 gi|116052832|ref|YP_793149.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|296391509|ref|ZP_06880984.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAb1]
 gi|313107349|ref|ZP_07793543.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 39016]
 gi|9950944|gb|AAG08074.1|AE004882_5 ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PAO1]
 gi|115588053|gb|ABJ14068.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|310880045|gb|EFQ38639.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa 39016]
          Length = 335

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--P 66
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  AALACLLGSLSLNAAADPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 67  PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV+ T++   L    +  LL KL    +          N   + I+  T+
Sbjct: 72  ITEEGARSPADVLYTEESPPLIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|49087450|gb|AAT51460.1| PA4687 [synthetic construct]
          Length = 336

 Score =  201 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--P 66
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  AALACLLGSPSLNAAADPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 67  PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV+ T++   L    +  LL KL    +          N   + I+  T+
Sbjct: 72  ITEEGARSPADVLYTEESPPLIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|152988703|ref|YP_001350724.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PA7]
 gi|150963861|gb|ABR85886.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa PA7]
          Length = 335

 Score =  201 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI 68
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  ATLACLLGSLSLNAAADPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 69  ----TQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
                + SP DV+ T++   L    +  LL +L    +          N   + I+  T+
Sbjct: 72  ITEEGERSPADVLYTEESPPLIRLASAGLLARLEPETLALVEPEHAGGNGDWIGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|254238574|ref|ZP_04931897.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa C3719]
 gi|126170505|gb|EAZ56016.1| ferric iron-binding periplasmic protein HitA [Pseudomonas
           aeruginosa C3719]
          Length = 335

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 6/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--P 66
             L     + + +       LTLY  Q+ +  + I  +F+++TG+++        Q    
Sbjct: 12  AALACLLGSLSLNAAADPVTLTLYNGQHAATGIAIAKAFQDKTGIQVKIRKGGDGQLASQ 71

Query: 67  PITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV+ T++   L    +  LL KL    +          N   + I+  T+
Sbjct: 72  ITEEGARSPADVLYTEESPPLIRLASAGLLAKLEPETLALVEPEHAGGNGDWIGITARTR 131

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           VLAY+ K+I   DLPKS+ DL++  W  R    P + +F   +  + +   +   +D++ 
Sbjct: 132 VLAYNPKKIDEKDLPKSLMDLSDPSWSGRFGFVPTSGAFLEQVAAVIKLKGQEEAEDWLT 191

Query: 183 NITA 186
            + A
Sbjct: 192 GLKA 195


>gi|312958660|ref|ZP_07773180.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311287203|gb|EFQ65764.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 341

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 79/175 (45%), Gaps = 6/175 (3%)

Query: 18  EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SP 73
              +       LTLY  Q++ V   +  +FE RTG+ ++    SS Q     + +G  SP
Sbjct: 27  SPAAYSADKVSLTLYNGQHKEVGDELAKAFEARTGIHVNVRKGSSNQLASQVVEEGDRSP 86

Query: 74  VDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
            DVI T++   L     + LL ++ A  +          N   M ++  T+V+A++ K I
Sbjct: 87  ADVIYTEESPPLNKLGEQGLLARIDAGTLDVLPKDYVGRNGDWMGVTARTRVVAFNPKLI 146

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
              DLPKSV D    +W+ ++   P + +F      + +   +   ++++  + A
Sbjct: 147 AEKDLPKSVLDFAAPEWQGKVGFVPTSGAFQEQAVAIIKLHGREAAEEWLTGLRA 201


>gi|320451372|ref|YP_004203468.1| iron(III)-binding protein [Thermus scotoductus SA-01]
 gi|320151541|gb|ADW22919.1| iron(III)-binding protein [Thermus scotoductus SA-01]
          Length = 331

 Score =  200 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 81/184 (44%), Gaps = 11/184 (5%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQ 70
           L G           + LTLY+ + QS++ P++  F+  TG+++   Y +  Q       +
Sbjct: 9   LIGLAALGLVFAQQQTLTLYSGRGQSLVEPLVKQFQAETGIRVQVRYGTDAQILAALQEE 68

Query: 71  G--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAY 126
           G  SP DV       +L    ++ LL  L   L+++        +K  + ++   +VLAY
Sbjct: 69  GSRSPADVFWANTAGALGQAASKGLLRPLGDTLLRQ-PVAFVPASKAWVPVTLRLRVLAY 127

Query: 127 STKRIKIADLPKSVFDLTNAQWK----KRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           + +++K  +LP S+ DL     +     R+   P   SF  ++  M     +   ++++ 
Sbjct: 128 NPQKLKPEELPASILDLPRFAQEKGLAGRVGWTPTYSSFQDMVAGMIALYGEAKTREWLS 187

Query: 183 NITA 186
            + A
Sbjct: 188 AMKA 191


>gi|325283552|ref|YP_004256093.1| extracellular solute-binding protein family 1 [Deinococcus
           proteolyticus MRP]
 gi|324315361|gb|ADY26476.1| extracellular solute-binding protein family 1 [Deinococcus
           proteolyticus MRP]
          Length = 331

 Score =  200 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 83/184 (45%), Gaps = 7/184 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI 68
             L+      A S+   +  +TLY+ + ++ + PI+  FE+ TG+K++  Y    +   +
Sbjct: 4   VFLMAGALMLAGSSVAQSGSITLYSGRGKTFVEPIVQRFEKETGIKVNVRYGKDAELVAL 63

Query: 69  --TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP DV       ++    ++    +L  +L +  +      +   +  +   +
Sbjct: 64  LRQEGARSPADVFWGNSLGAMGQLDSDGRFVRLGNNLSRNVARQYMPASGNWVPTTVRFR 123

Query: 123 VLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
            LAYS++R+K + LP SVFDL    Q+K R+    +  SF   L  M     +   + ++
Sbjct: 124 TLAYSSERVKASQLPASVFDLPKMTQFKGRIGWTLSYPSFQDFLAGMIAQHGEAKTRQWL 183

Query: 182 KNIT 185
            ++ 
Sbjct: 184 LDMK 187


>gi|325271220|ref|ZP_08137765.1| extracellular solute-binding protein [Pseudomonas sp. TJI-51]
 gi|324103623|gb|EGC00925.1| extracellular solute-binding protein [Pseudomonas sp. TJI-51]
          Length = 337

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 47/190 (24%), Positives = 86/190 (45%), Gaps = 9/190 (4%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQR--PPITQG--SPVDVIITKDET--SLALNEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
            Q     I +G  SP D+I T++    +      LL K+    +          N   M 
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMLPKEYVAANGTWMG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           ++  T+V+ Y+ K+I   DLP +V D  N  W+ R+   P + +F      + +   +  
Sbjct: 128 VTARTRVVVYNPKKIDEKDLPTTVMDFANPDWEGRVGYVPTSGAFQEQAVAILKMHGREA 187

Query: 177 VQDFIKNITA 186
            ++++  + A
Sbjct: 188 TEEWLTGLKA 197


>gi|70734078|ref|YP_257718.1| iron(III) ABC transporter periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68348377|gb|AAY95983.1| iron(III) ABC transporter, periplasmic-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 341

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 85/200 (42%), Gaps = 14/200 (7%)

Query: 1   MFKRTIYTYLLL--------LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTG 52
           MF+ T+    LL               F+       LTLY  Q++ V   +  +FE +TG
Sbjct: 2   MFRNTLLPTSLLRGLTITLLGLTLASPFTQAADPVSLTLYNGQHKEVGDAVAKAFEAKTG 61

Query: 53  VKISPIYTSSIQRPP--ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFV 106
           + ++    SS Q     + +G  SP DVI T++   L     + LL +     +      
Sbjct: 62  IHVNVRKGSSNQLASQVVEEGDRSPADVIYTEESPPLNKLGEQGLLAQTDTTTLAVLPKE 121

Query: 107 LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLN 166
               N   + ++   +V+A++ K I   DLPKSV + +  QW+ ++   P + +F     
Sbjct: 122 YVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSVMEFSQPQWQGKVGFVPTSGAFQEQAV 181

Query: 167 TMEQTPNKTVVQDFIKNITA 186
            + +   +   ++++  + A
Sbjct: 182 AIIKMHGRDAAEEWLTGLRA 201


>gi|26991560|ref|NP_746985.1| iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|148549963|ref|YP_001270065.1| extracellular solute-binding protein [Pseudomonas putida F1]
 gi|24986646|gb|AAN70449.1|AE016686_3 iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|148514021|gb|ABQ80881.1| extracellular solute-binding protein, family 1 [Pseudomonas putida
           F1]
 gi|313500864|gb|ADR62230.1| Iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida BIRD-1]
          Length = 337

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 86/190 (45%), Gaps = 9/190 (4%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    T  LT+Y  Q++ +   I  ++E +TG+ I     SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHIDIRKGSS 67

Query: 63  IQR--PPITQG--SPVDVIITKDETSLALNEDLL--HKLPAHLIKKNSFVLKNENKKLMR 116
            Q     I +G  SP D+I T++   L    +L    K+    +          N   M 
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMMPKEYVGANGTWMG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  T+++ Y+ K++   DLP +V D  N +W+ R+   P + +F      + +   +  
Sbjct: 128 ITARTRIVVYNPKKVDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAILKMHGREA 187

Query: 177 VQDFIKNITA 186
            ++++  + A
Sbjct: 188 TEEWLTGLKA 197


>gi|170723832|ref|YP_001751520.1| extracellular solute-binding protein [Pseudomonas putida W619]
 gi|169761835|gb|ACA75151.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           W619]
          Length = 337

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 88/190 (46%), Gaps = 9/190 (4%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A + +  T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAAVLSLVMGAPAAMADDPVT--LTMYNGQHKEIGEAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQR--PPITQG--SPVDVIITKDETSLALNEDLL--HKLPAHLIKKNSFVLKNENKKLMR 116
            Q     I +G  SP D+I T++   L    +L    K+    +          N   M 
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMLPKEYVAANGSWMG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           ++  T+V+ ++ K+I   DLP+SV D  N +W  ++   P + +F      + +   +  
Sbjct: 128 VTARTRVVVFNPKKIDEKDLPQSVMDFANPEWDGKVGFVPTSGAFQEQAVAILKMHGRDA 187

Query: 177 VQDFIKNITA 186
            ++++  + A
Sbjct: 188 AEEWLTGLKA 197


>gi|167035926|ref|YP_001671157.1| extracellular solute-binding protein [Pseudomonas putida GB-1]
 gi|166862414|gb|ABZ00822.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           GB-1]
          Length = 337

 Score =  196 bits (500), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 85/190 (44%), Gaps = 9/190 (4%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   +L L+ G   A +    +  LT+Y  Q++ +   I  ++E +TG+ I     SS
Sbjct: 10  RTLAAAVLSLVIGAPAAMADAPVS--LTMYNGQHKEIGEAIAKAYEAKTGIHIDIRKGSS 67

Query: 63  IQR--PPITQG--SPVDVIITKDET--SLALNEDLLHKLPAHLIKKNSFVLKNENKKLMR 116
            Q     I +G  SP D+I T++    +      LL K+               N   M 
Sbjct: 68  NQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATANMMPKEYVGANGTWMG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  T+++ Y+ K++   DLP +V D  N +W+ R+   P + +F      + +   +  
Sbjct: 128 ITARTRIVVYNPKKVDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAILKMHGREA 187

Query: 177 VQDFIKNITA 186
            ++++  + A
Sbjct: 188 TEEWLTGLKA 197


>gi|46199566|ref|YP_005233.1| iron(III)-binding protein [Thermus thermophilus HB27]
 gi|46197192|gb|AAS81606.1| iron(III)-binding protein [Thermus thermophilus HB27]
          Length = 330

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITK 80
            +  LT+Y+ + QS++ P++  FE  TG+++   Y +  Q       +G  SP D+    
Sbjct: 20  QSPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYGTDAQILAALQEEGSRSPADLFWAN 79

Query: 81  DETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
              +L     + LL  L   L++K        ++  + ++   +VLAY+  RIK  +LP+
Sbjct: 80  TAGALGQASAKGLLRPLGETLLEK-PIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPE 138

Query: 139 SVFDLTNAQWK----KRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           S+ DL     +     R+   P   SF  ++  M     +   ++++  + A
Sbjct: 139 SLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKA 190


>gi|325578694|ref|ZP_08148770.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325159733|gb|EGC71864.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 332

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 16/199 (8%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F+    T L+   GF  A         +T+Y  Q++     +  +F + TG+K++     
Sbjct: 6   FQIAALTGLMAFAGFASA--------DITVYNGQHKEGAKAVADAFTKATGIKVTLNSAK 57

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNS--FVLKNENKK 113
           S Q       +G  +P DV  ++     A   +  LL  L A  IK+ +   V     K 
Sbjct: 58  SDQLAGQLKEEGDKTPADVFFSEQTAPFAALSDAGLLEPLSADTIKQTAHKGVPVAPKKD 117

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
            + +S  ++V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +   
Sbjct: 118 WVALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVVAITKLKG 177

Query: 174 KTVVQDFIKNITANEILTK 192
           K     ++K +  N  L  
Sbjct: 178 KDAALKWLKGLKENGKLYA 196


>gi|167841866|ref|ZP_02468550.1| ABC Fe3+ transporter, periplasmic ligand binding protein
           [Burkholderia thailandensis MSMB43]
          Length = 302

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 73/160 (45%), Gaps = 6/160 (3%)

Query: 35  QNQSVMLPIIHSFEERTGVKISPIYTS--SIQRPPITQG--SPVDVIITKDETSLA--LN 88
           Q++ V+  ++  FE +TG+ +        ++    + +G  +P DV  T++   L     
Sbjct: 1   QHEQVVNQLVKDFEAQTGITVKVRTGEGPALAAQLVAEGDRTPADVYFTENSPELVLLAE 60

Query: 89  EDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQW 148
           + LL K  A  +        + +   + +     VL Y+T +I+   LP S+ DL   +W
Sbjct: 61  KGLLAKTDAATLAAVPARFSSPDGDWVGVLARENVLIYNTAKIQPRQLPASLVDLAKPEW 120

Query: 149 KKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
           K ++ IAP++  F  L++ M     +     ++K + AN 
Sbjct: 121 KGKVGIAPSDADFLPLVSGMLALKGEAQTLQWLKGLKANA 160


>gi|104783864|ref|YP_610362.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           entomophila L48]
 gi|95112851|emb|CAK17579.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas entomophila L48]
          Length = 337

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 87/190 (45%), Gaps = 9/190 (4%)

Query: 4   RTIYTYLL-LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           RT+   LL L+ G   A + E  T  LT+Y  Q++ +   I  ++E +TG+ I+    SS
Sbjct: 10  RTLAAALLSLVIGAPAALADEPVT--LTMYNGQHKEIGDAIAKAYEAKTGIHINIRKGSS 67

Query: 63  IQR--PPITQG--SPVDVIITKDETSLALNEDLL--HKLPAHLIKKNSFVLKNENKKLMR 116
            Q     I +G  SP D+I T++   L    +L    K+               N   M 
Sbjct: 68  NQLASQIIEEGERSPADIIYTEESPPLNNLGELGLLAKIDDATANMMPKEYVGANGTWMG 127

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTV 176
           I+  T+++ ++ K+I   DLP +V D  N +W+ R+   P + +F      + +   +  
Sbjct: 128 ITARTRIVVFNPKKIDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAILKMHGREA 187

Query: 177 VQDFIKNITA 186
            ++++  + A
Sbjct: 188 TEEWLTGLKA 197


>gi|301155985|emb|CBW15455.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 332

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 16/199 (8%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F+    T L+   GF  A         +T+Y  Q++     +  +F + TG+K++     
Sbjct: 6   FQIAALTGLMAFAGFASA--------DITVYNGQHKEGSQAVADAFTKATGIKVTLNSAK 57

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNS--FVLKNENKK 113
           S Q       +G  +P DV  ++     A   +  LL  L A  IK+ +   V     K 
Sbjct: 58  SDQLAGQLKEEGDKTPADVFFSEQTAPFAALSDAGLLEPLSADTIKQTAHKGVPVAPKKD 117

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPN 173
            + +S  ++V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +   
Sbjct: 118 WVALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVVAITKLKG 177

Query: 174 KTVVQDFIKNITANEILTK 192
           K     ++K +  N  L  
Sbjct: 178 KDAALKWLKGLKENGKLYA 196


>gi|55981597|ref|YP_144894.1| iron ABC transporter periplasmic iron-binding protein [Thermus
           thermophilus HB8]
 gi|55773010|dbj|BAD71451.1| iron ABC transporter, periplasmic iron-binding protein [Thermus
           thermophilus HB8]
          Length = 330

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITK 80
            +  LT+Y+ + QS++ P++  FE  TG+++   Y++  Q       +G  SP D+    
Sbjct: 20  QSPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWAN 79

Query: 81  DETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
              +L     + LL  L   L++K        ++  + ++   +VLAY+  RIK  +LP+
Sbjct: 80  TAGALGQASAKGLLRPLGETLLEK-PIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPE 138

Query: 139 SVFDLTNAQWK----KRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           S+ DL     +     R+   P   SF  ++  M     +   ++++  + A
Sbjct: 139 SLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKA 190


>gi|182441092|dbj|BAG24189.1| iron ABC transporter, periplasmic iron-binding protein [Thermus
           thermophilus]
          Length = 328

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 81/170 (47%), Gaps = 9/170 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITK 80
            +  LT+Y+ + QS++ P++  FE  TG+++   Y++  Q       +G  SP DV+   
Sbjct: 20  QSPTLTIYSGRGQSLVEPLVKRFEAETGIRVQVRYSTDAQILAALQEEGNRSPADVLWLN 79

Query: 81  DETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
              +L     + LL  L   L+ K        +K  + ++   +VLAY+  ++K  +LP+
Sbjct: 80  TSGALGQAAAKGLLRPLGESLLGK-PLAFVPGSKAWVPVTMRLRVLAYNPNKVKAEELPQ 138

Query: 139 SVFDLTN-AQWKK-RLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           S+ DL   AQ K  R+   P   SF  ++  +     +   ++++  + A
Sbjct: 139 SLLDLPRFAQEKGLRVGWTPTYSSFQDMVAGILALHGEAKAREWLLAMKA 188


>gi|261867323|ref|YP_003255245.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412655|gb|ACX82026.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 332

 Score =  191 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           +      +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV 
Sbjct: 18  STAAFADITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKI 133
            ++     A      LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YSEQTAPFAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++   P + +F   +  + +   +    D++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKLYA 196


>gi|293390932|ref|ZP_06635266.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951466|gb|EFE01585.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 332

 Score =  191 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           +      +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV 
Sbjct: 18  STAAFADITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKI 133
            ++     A      LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YSEQTAPFAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++   P + +F   +  + +   +    D++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKLYA 196


>gi|2340838|dbj|BAA21842.1| ferric iron binding protein [Aggregatibacter actinomycetemcomitans]
          Length = 332

 Score =  191 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           +      +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV 
Sbjct: 18  STAAFADITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKI 133
            ++     A      LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YSEQTAPFAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++   P + +F   +  + +   +    D++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKAALDWLKGLKENGKLYA 196


>gi|331700342|ref|YP_004336581.1| extracellular solute-binding protein family 1 [Pseudonocardia
           dioxanivorans CB1190]
 gi|326955031|gb|AEA28728.1| extracellular solute-binding protein family 1 [Pseudonocardia
           dioxanivorans CB1190]
          Length = 348

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 84/171 (49%), Gaps = 6/171 (3%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP--ITQG--SPVDVIIT 79
           +  + L +Y+ + ++++  +I  FE+ +G+K+   Y S+ +     + +G  +P  V ++
Sbjct: 39  SGDRTLVVYSGREEALVGELIKQFEQTSGIKVETRYGSTTELAAQLLEEGDRTPAQVFLS 98

Query: 80  KDETSLALNEDL--LHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           ++  +L        L  LPA +         +++   + ++   +V+AY ++      +P
Sbjct: 99  QESGALGAVAAAGHLTTLPADVTSAVPANYTSKDGSWVGLTGRARVIAYDSRTYAADQVP 158

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
             + +L   QWK +++IAP N SF   +  +  T  +   + +++ + ANE
Sbjct: 159 GDITELVQPQWKGKIAIAPTNASFQAHVTALRVTAGEEAARAWVQGLKANE 209


>gi|251793332|ref|YP_003008060.1| ferric iron binding protein [Aggregatibacter aphrophilus NJ8700]
 gi|247534727|gb|ACS97973.1| ferric iron binding protein [Aggregatibacter aphrophilus NJ8700]
          Length = 332

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPI 68
           L       AFS       +T+Y  Q++     +  +F + TG+K++     S Q      
Sbjct: 8   LATLAAAIAFSGVAAAD-ITVYNGQHKEAAKAVTEAFMKETGIKVTLNSAKSEQLAGQLK 66

Query: 69  TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQ 122
            +G  +P DV  T+   + A   ++ LL  L A  IK+  +  V     K  + +S  ++
Sbjct: 67  EEGDKTPADVFYTEQIGTFAELSDKGLLEPLSAETIKQTEYKGVPVAPKKDWVALSGRSR 126

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +  ++    D++K
Sbjct: 127 VVVYDKNKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLSQVIAITKLKSEQAALDWLK 186

Query: 183 NITANEILTK 192
            +  N  L  
Sbjct: 187 GLKENGKLYA 196


>gi|313668878|ref|YP_004049162.1| major ferric iron binding protein [Neisseria lactamica ST-640]
 gi|313006340|emb|CBN87803.1| major ferric iron binding protein [Neisseria lactamica 020-06]
          Length = 331

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+      S Q       +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEATQALADAFTRATGIKVKVNSGKSDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  PLVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V +    +WK R+   P + +F   +  + +   +     ++K +  N  L  
Sbjct: 143 VLNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKLYA 195


>gi|315635010|ref|ZP_07890291.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
 gi|315476272|gb|EFU67023.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
          Length = 332

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 81/194 (41%), Gaps = 8/194 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR- 65
            + L L         +      +T+Y  Q++     +  +F + TG+K++     S Q  
Sbjct: 3   LSALKLATLTAALAFSSAAFADITVYNGQHKEAAKAVTEAFTKETGIKVTLNSAKSEQLA 62

Query: 66  -PPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSF--VLKNENKKLMRIS 118
                +G  +P DV  T+   S     + DLL  L A +IK+  +  V     K  + +S
Sbjct: 63  GQLKEEGDKTPADVFYTEQVASFVGLSDADLLEPLSADIIKQTQYKGVPVAPKKDWIALS 122

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             ++V+ Y   ++   D+ KSV D    +WK ++   P + +F   +  + +   +    
Sbjct: 123 GRSRVVVYDKNKLSEKDMEKSVLDYATPKWKDKIGYVPTSGAFLEQVVAITKLKGEKAAL 182

Query: 179 DFIKNITANEILTK 192
           D++K +  N  L  
Sbjct: 183 DWLKGLKENGKLYA 196


>gi|309378960|emb|CBX22413.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           lactamica Y92-1009]
          Length = 331

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+      S Q       +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEATQALADAFTRATGIKVKVNSGKSDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  PLVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V +    +WK R+   P + +F   +  + +   +     ++K +  N  L  
Sbjct: 143 VLNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKLYA 195


>gi|296315008|ref|ZP_06864949.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria polysaccharea ATCC 43768]
 gi|296838209|gb|EFH22147.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria polysaccharea ATCC 43768]
          Length = 331

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F + TG+K+      S Q       +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEATQALADAFTQATGIKVKINSGKSDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            L      +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  PLVTLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V +    +WK R+   P + +F   +  + +   +     ++K +  N  L  
Sbjct: 143 VLNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKGLKENGKLYA 195


>gi|328949603|ref|YP_004366938.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328449927|gb|AEB10828.1| extracellular solute-binding protein family 1 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 355

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 8/185 (4%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP- 67
           + +LL G   A +     + L +Y+ +++ ++ P++  FE +TG+++   Y    +    
Sbjct: 5   FSVLLTGILAASAFSYAAEELVVYSGRSEVLVEPLVERFEAQTGIRVKVRYGRDAELLAT 64

Query: 68  -ITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
              +G  SP D+       +L    NE LL  L    +          + + + ++   +
Sbjct: 65  LAEEGARSPADLFWANTAGALGAAVNEGLLAPL-PEELLALPEAFTPSSGRWVPLTARFR 123

Query: 123 VLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
           VLAY+ + +    LP+SV DL    +   R+   PN  SF   +  M           ++
Sbjct: 124 VLAYNPEVLSAEALPESVMDLPKRTELAGRIGWTPNYSSFQDFITAMRHLYGPEATLKWL 183

Query: 182 KNITA 186
           + + A
Sbjct: 184 EGMKA 188


>gi|261377950|ref|ZP_05982523.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria cinerea ATCC 14685]
 gi|269145811|gb|EEZ72229.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria cinerea ATCC 14685]
          Length = 331

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 78/188 (41%), Gaps = 8/188 (4%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPIT 69
           L    T   ++      + LY  Q++     +  +F + TG+K+      S Q       
Sbjct: 7   LALLTTALIASSPAFADIVLYNGQHKEATQALADAFTKSTGIKVKINSGKSDQLAGQIKE 66

Query: 70  QGS--PVDVIITKDETSLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQV 123
           +GS  P DV  ++    LA     +LL  LPA  I   +   V     K  + +S  ++V
Sbjct: 67  EGSRSPADVFYSEQIPPLATLSAANLLETLPAKTINDTRRKGVPVAAKKDWVALSGRSRV 126

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKN 183
           + Y ++++   DL KSV +    +WK R+   P + +F   +  + +   +     ++K 
Sbjct: 127 VVYDSRKLSEKDLEKSVLNYATPKWKDRIGYVPTSGAFLEQVVAIVKLKGEAAALKWLKG 186

Query: 184 ITANEILT 191
           +  N  L 
Sbjct: 187 LKENGKLY 194


>gi|225075818|ref|ZP_03719017.1| hypothetical protein NEIFLAOT_00834 [Neisseria flavescens
           NRL30031/H210]
 gi|224952851|gb|EEG34060.1| hypothetical protein NEIFLAOT_00834 [Neisseria flavescens
           NRL30031/H210]
          Length = 331

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 189


>gi|218767768|ref|YP_002342280.1| major ferric iron binding protein [Neisseria meningitidis Z2491]
 gi|60416398|sp|P0A0Y3|FBPA_NEIMA RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Iron(III) periplasmic-binding protein;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|121051776|emb|CAM08082.1| major ferric iron binding protein [Neisseria meningitidis Z2491]
 gi|319410020|emb|CBY90353.1| iron(III)-transport system iron-binding protein FbpB (major ferric
           iron-binding protein; FBP; major iron-regulated protein;
           MIRP; Iron(III) periplasmic binding protein) [Neisseria
           meningitidis WUE 2594]
 gi|325197847|gb|ADY93303.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis G2136]
          Length = 331

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 189


>gi|121634427|ref|YP_974672.1| major ferric iron binding protein [Neisseria meningitidis FAM18]
 gi|120866133|emb|CAM09872.1| major ferric iron binding protein [Neisseria meningitidis FAM18]
 gi|308388821|gb|ADO31141.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis alpha710]
 gi|325203726|gb|ADY99179.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240355]
          Length = 331

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 189


>gi|15676534|ref|NP_273677.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis MC58]
 gi|161869567|ref|YP_001598734.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis 053442]
 gi|254804517|ref|YP_003082738.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|261401098|ref|ZP_05987223.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria lactamica ATCC 23970]
 gi|304388120|ref|ZP_07370246.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Neisseria meningitidis ATCC 13091]
 gi|60392270|sp|P0A0Y4|FBPA_NEIMB RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Iron(III) periplasmic-binding protein;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|7225862|gb|AAF41057.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis MC58]
 gi|161595120|gb|ABX72780.1| iron(III) ABC transporter, periplasmic binding protein [Neisseria
           meningitidis 053442]
 gi|254668059|emb|CBA04515.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|261392998|emb|CAX50584.1| iron(III)-transport system iron-binding protein FbpB (major ferric
           iron-binding protein; FBP; major iron-regulated protein;
           MIRP; Iron(III) periplasmic binding protein) [Neisseria
           meningitidis 8013]
 gi|269208994|gb|EEZ75449.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria lactamica ATCC 23970]
 gi|304337890|gb|EFM04033.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Neisseria meningitidis ATCC 13091]
 gi|325127753|gb|EGC50662.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis N1568]
 gi|325131915|gb|EGC54615.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M6190]
 gi|325133851|gb|EGC56507.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M13399]
 gi|325135772|gb|EGC58384.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M0579]
 gi|325137966|gb|EGC60541.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis ES14902]
 gi|325139815|gb|EGC62347.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis CU385]
 gi|325143980|gb|EGC66290.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240013]
 gi|325200680|gb|ADY96135.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis H44/76]
 gi|325202572|gb|ADY98026.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M01-240149]
 gi|325206519|gb|ADZ01972.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis M04-240196]
 gi|325207678|gb|ADZ03130.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis NZ-05/33]
          Length = 331

 Score =  187 bits (475), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 189


>gi|1498595|gb|AAB66501.1| periplasmic iron repressible protein [Aggregatibacter
           actinomycetemcomitans]
          Length = 332

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 75/179 (41%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           +      +T+Y+ Q++     +  +F + TG+K++     S Q       +G  +P DV 
Sbjct: 18  STAAFADITVYSGQHKEGAKAVADAFTKETGIKVTLNSAKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLAL--NEDLLHKLPAHLIKKNSF--VLKNENKKLMRISFDTQVLAYSTKRIKI 133
            ++     A      LL  L A  IK+  +  V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YSEQTAPFAALSEAGLLEPLSAETIKQTEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV      +WK ++   P + +F   +  + +   +    D++K +  N  L  
Sbjct: 138 KDMEKSVLVHATPKWKDKIGYVPTSGAFLEQVIAITKLKGEKSALDWLKGLKENGKLYA 196


>gi|45245|emb|CAA46064.1| periplasmic iron-binding protein [Neisseria meningitidis]
          Length = 317

 Score =  186 bits (474), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 15  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 74

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 75  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 134

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 135 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 181


>gi|325129733|gb|EGC52542.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Neisseria meningitidis OX99.30304]
          Length = 318

 Score =  186 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 74/174 (42%), Gaps = 8/174 (4%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDV 76
           +       +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV
Sbjct: 3   AATPALADITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADV 62

Query: 77  IITKDETSLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
             ++   +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++ 
Sbjct: 63  FYSEQIPALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLS 122

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
             DL KSV +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 123 EKDLEKSVLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 176


>gi|45014|emb|CAA46070.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45046|emb|CAA46069.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45052|emb|CAA46065.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45058|emb|CAA46068.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45102|emb|CAA46071.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45158|emb|CAA46067.1| periplasmic iron-binding protein [Neisseria meningitidis]
 gi|45174|emb|CAA46066.1| periplasmic iron-binding protein [Neisseria meningitidis]
          Length = 317

 Score =  186 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 15  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 74

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 75  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 134

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 135 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 181


>gi|45038|emb|CAA37561.1| unnamed protein product [Neisseria meningitidis]
          Length = 330

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKALKE 189


>gi|119851|sp|P17259|FBP_NEIGO RecName: Full=Major ferric iron-binding protein; Short=FBP;
           AltName: Full=Major iron-regulated protein; Short=MIRP;
           Flags: Precursor
 gi|44858|emb|CAA36182.1| unnamed protein product [Neisseria gonorrhoeae]
          Length = 330

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 189


>gi|6573535|pdb|1D9Y|A Chain A, Neisseria Gonorrhoeae Ferric Binding Protein
          Length = 309

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 1   DITVYNGQHKEAAQAVADAFTRATGIKVKLNCAKGDQLAGQIKEEGSRSPADVFYSEQIP 60

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 61  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 121 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 167


>gi|59800670|ref|YP_207382.1| ABC transporter, periplasmic binding protein, iron related
           [Neisseria gonorrhoeae FA 1090]
 gi|194097929|ref|YP_002000975.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998402|ref|ZP_04718326.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           35/02]
 gi|240013527|ref|ZP_04720440.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           DGI18]
 gi|240015965|ref|ZP_04722505.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           FA6140]
 gi|240080106|ref|ZP_04724649.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           FA19]
 gi|240112318|ref|ZP_04726808.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           MS11]
 gi|240115059|ref|ZP_04729121.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID18]
 gi|240117344|ref|ZP_04731406.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID1]
 gi|240120599|ref|ZP_04733561.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID24-1]
 gi|240122895|ref|ZP_04735851.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           PID332]
 gi|240125151|ref|ZP_04738037.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493121|ref|ZP_05106292.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae 1291]
 gi|260441125|ref|ZP_05794941.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           DGI2]
 gi|268594261|ref|ZP_06128428.1| major ferric iron-binding protein [Neisseria gonorrhoeae 35/02]
 gi|268596258|ref|ZP_06130425.1| major ferric iron-binding protein [Neisseria gonorrhoeae FA19]
 gi|268598379|ref|ZP_06132546.1| major ferric iron binding protein [Neisseria gonorrhoeae MS11]
 gi|268600734|ref|ZP_06134901.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID18]
 gi|268603040|ref|ZP_06137207.1| major ferric iron binding protein [Neisseria gonorrhoeae PID1]
 gi|268681515|ref|ZP_06148377.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID332]
 gi|268683745|ref|ZP_06150607.1| major ferric iron binding protein [Neisseria gonorrhoeae SK-92-679]
 gi|291044456|ref|ZP_06570165.1| major ferric iron-binding protein [Neisseria gonorrhoeae DGI2]
 gi|293397590|ref|ZP_06641796.1| iron(III) transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|1098687|gb|AAB63559.1| binds iron in a manner similar to transferrin; periplasmic
           iron-binding protein; Method: conceptual translation
           supplied by author [Neisseria gonorrhoeae]
 gi|59717565|gb|AAW88970.1| ABC transporter, periplasmic binding protein, iron related
           [Neisseria gonorrhoeae FA 1090]
 gi|193933219|gb|ACF29043.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512161|gb|EEH61506.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae 1291]
 gi|268547650|gb|EEZ43068.1| major ferric iron-binding protein [Neisseria gonorrhoeae 35/02]
 gi|268550046|gb|EEZ45065.1| major ferric iron-binding protein [Neisseria gonorrhoeae FA19]
 gi|268582510|gb|EEZ47186.1| major ferric iron binding protein [Neisseria gonorrhoeae MS11]
 gi|268584865|gb|EEZ49541.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID18]
 gi|268587171|gb|EEZ51847.1| major ferric iron binding protein [Neisseria gonorrhoeae PID1]
 gi|268621799|gb|EEZ54199.1| major ferric iron-binding protein periplasmic-binding protein
           [Neisseria gonorrhoeae PID332]
 gi|268624029|gb|EEZ56429.1| major ferric iron binding protein [Neisseria gonorrhoeae SK-92-679]
 gi|291011350|gb|EFE03346.1| major ferric iron-binding protein [Neisseria gonorrhoeae DGI2]
 gi|291611536|gb|EFF40605.1| iron(III) transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|317163688|gb|ADV07229.1| ABC transporter, periplasmic binding protein, iron related protein
           [Neisseria gonorrhoeae TCDC-NG08107]
 gi|1588872|prf||2209379A fbpA gene
          Length = 331

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 143 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 189


>gi|145629023|ref|ZP_01784822.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.1-21]
 gi|144978526|gb|EDJ88249.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.1-21]
          Length = 292

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|383959|prf||1904330A ferric iron-binding protein
          Length = 308

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 1   DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 60

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 61  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 121 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 167


>gi|44849|emb|CAA46063.1| periplasmic iron-binding protein [Neisseria gonorrhoeae]
          Length = 317

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 15  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 74

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 75  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 134

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 135 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 181


>gi|47168691|pdb|1R1N|A Chain A, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168692|pdb|1R1N|B Chain B, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168693|pdb|1R1N|C Chain C, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168694|pdb|1R1N|D Chain D, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168695|pdb|1R1N|E Chain E, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168696|pdb|1R1N|F Chain F, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168697|pdb|1R1N|G Chain G, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168698|pdb|1R1N|H Chain H, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|47168699|pdb|1R1N|I Chain I, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding
           Protein From N. Gonorrhoeae
 gi|55670810|pdb|1XC1|A Chain A, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670811|pdb|1XC1|B Chain B, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670812|pdb|1XC1|C Chain C, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670813|pdb|1XC1|D Chain D, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670814|pdb|1XC1|E Chain E, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670815|pdb|1XC1|F Chain F, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670816|pdb|1XC1|G Chain G, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670817|pdb|1XC1|H Chain H, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
 gi|55670818|pdb|1XC1|I Chain I, Oxo Zirconium(Iv) Cluster In The Ferric Binding Protein
           (Fbp)
          Length = 309

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 1   DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 60

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 61  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 121 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 167


>gi|240127606|ref|ZP_04740267.1| Major ferric iron-binding protein precursor [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268685986|ref|ZP_06152848.1| major ferric iron binding protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626270|gb|EEZ58670.1| major ferric iron binding protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 331

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 23  DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 82

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 83  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 142

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   + V   ++K +  
Sbjct: 143 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAVALKWLKGLKE 189


>gi|28948312|pdb|1O7T|A Chain A, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948313|pdb|1O7T|B Chain B, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948314|pdb|1O7T|C Chain C, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948315|pdb|1O7T|D Chain D, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948316|pdb|1O7T|E Chain E, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948317|pdb|1O7T|F Chain F, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948318|pdb|1O7T|G Chain G, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948319|pdb|1O7T|H Chain H, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae.
 gi|28948320|pdb|1O7T|I Chain I, Metal Nanoclusters Bound To The Ferric Binding Protein
           From Neisseria Gonorrhoeae
          Length = 309

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDET 83
            +T+Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   
Sbjct: 1   DITVYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIP 60

Query: 84  SLA--LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           +LA     +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KS
Sbjct: 61  ALATLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           V +    +WK R+   P + +F   +  + +   +     ++K +  
Sbjct: 121 VLNYATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKE 167


>gi|37520583|ref|NP_923960.1| iron(III) ABC transporter iron (III)-binding protein [Gloeobacter
           violaceus PCC 7421]
 gi|35211577|dbj|BAC88955.1| iron(III) ABC transporter iron (III)-binding protein [Gloeobacter
           violaceus PCC 7421]
          Length = 355

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 91/200 (45%), Gaps = 12/200 (6%)

Query: 1   MFKRTIYTYLLLLCGFTEAFST---ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISP 57
           +F R     +L + G   A  +      ++ L +Y+ + + ++ P++  F++ TGV++  
Sbjct: 20  VFTRRQVLGVLAVGGLFTAVPSVGLAQGSEELVVYSGRKEPLIQPVLERFQKETGVRVVL 79

Query: 58  IYTSSIQRP---PITQGSP-VDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNEN 111
               +          Q +P  DV +  D   L    N  +L    +  I+K     +   
Sbjct: 80  KSGDASALANQLLEEQKNPQADVFVANDAGVLGRLGNLGVLQPYQSASIEKIPARYRGAG 139

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQ 170
              + ++   +V+ Y+   IK ADLPKS+ DL++ ++K +++ A   N S    L+ M Q
Sbjct: 140 --WVGVTGRARVIMYNKSLIKEADLPKSLLDLSDPKYKGKIAAAGTANESMLGQLSEMRQ 197

Query: 171 TPNKTVVQDFIKNITANEIL 190
                  ++F++++ AN+  
Sbjct: 198 VLGDEKTREFVRSLVANQTT 217


>gi|319775037|ref|YP_004137525.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3047]
 gi|329123055|ref|ZP_08251626.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus aegyptius ATCC 11116]
 gi|317449628|emb|CBY85834.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3047]
 gi|327471986|gb|EGF17426.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Haemophilus aegyptius ATCC 11116]
          Length = 332

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPI 68
           L       AFS  +    +T+Y  Q++     +  +FE+ TG+K++     S Q      
Sbjct: 8   LATLVAALAFSANSFAD-ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLK 66

Query: 69  TQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQ 122
            +G  +P DV  T+   + A      LL  +    IK+ +   V     K  + +S  ++
Sbjct: 67  EEGDKTPADVFYTEQTATFAALSEAGLLAPISEQTIKQTAQKGVPLAPKKDWVALSGRSR 126

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V+ Y   ++   D+ KSV D    +WK ++     + +F   +  + +     V  +++K
Sbjct: 127 VVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLK 186

Query: 183 NITANEILTK 192
            +  N  L  
Sbjct: 187 GLKENGKLYA 196


>gi|148825628|ref|YP_001290381.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittEE]
 gi|319896538|ref|YP_004134731.1| iron-utilization periplasmic protein hfbpa [Haemophilus influenzae
           F3031]
 gi|148715788|gb|ABQ97998.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittEE]
 gi|309972773|gb|ADO95974.1| Iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae R2846]
 gi|317432040|emb|CBY80389.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           F3031]
          Length = 332

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|30995354|ref|NP_438271.2| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           Rd KW20]
          Length = 332

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPI 68
           L       AFS  +    +T+Y  Q++     +  +FE+ TG+K++     S Q      
Sbjct: 8   LATLAAHLAFSANSFAD-ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLK 66

Query: 69  TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQ 122
            +G  +P DV  T+   + A      LL  +    I++ +   V     K  + +S  ++
Sbjct: 67  EEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSR 126

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIK 182
           V+ Y   ++   D+ KSV D    +WK ++     + +F   +  + +     V  +++K
Sbjct: 127 VVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLK 186

Query: 183 NITANEILTK 192
            +  N  L  
Sbjct: 187 GLKENGKLYA 196


>gi|145642008|ref|ZP_01797580.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|145273279|gb|EDK13153.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           22.4-21]
          Length = 332

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITIYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|145631531|ref|ZP_01787299.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|260581987|ref|ZP_05849782.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           NT127]
 gi|144982876|gb|EDJ90393.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           R3021]
 gi|260094877|gb|EEW78770.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           NT127]
          Length = 332

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|145637674|ref|ZP_01793328.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittHH]
 gi|145269134|gb|EDK09083.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittHH]
          Length = 332

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|68248708|ref|YP_247820.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           86-028NP]
 gi|145639598|ref|ZP_01795202.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittII]
 gi|148827241|ref|YP_001291994.1| iron-utilization periplasmic protein FbpA [Haemophilus influenzae
           PittGG]
 gi|229847064|ref|ZP_04467170.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           7P49H1]
 gi|260580598|ref|ZP_05848425.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           RdAW]
 gi|2507358|sp|P35755|FBPA_HAEIN RecName: Full=Iron-utilization periplasmic protein; AltName:
           Full=Fe(3+)-binding protein; AltName:
           Full=Iron-regulated 40 kDa protein; AltName: Full=Major
           ferric iron-binding protein; Short=MIRP; Flags:
           Precursor
 gi|68056907|gb|AAX87160.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           86-028NP]
 gi|145271389|gb|EDK11302.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittII]
 gi|148718483|gb|ABQ99610.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittGG]
 gi|229810148|gb|EEP45868.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           7P49H1]
 gi|260092660|gb|EEW76596.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           RdAW]
 gi|301168756|emb|CBW28347.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           10810]
 gi|309750486|gb|ADO80470.1| Iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae R2866]
          Length = 332

 Score =  181 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|82701865|ref|YP_411431.1| extracellular solute-binding protein [Nitrosospira multiformis ATCC
           25196]
 gi|82409930|gb|ABB74039.1| extracellular solute-binding protein, family 1 [Nitrosospira
           multiformis ATCC 25196]
          Length = 337

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 83/187 (44%), Gaps = 9/187 (4%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQ 64
              ++C  T   +  +  + + +Y+ + + ++ P+  +F + +GV +  +         +
Sbjct: 10  LTAMICCVTLFTADASGAEDVVVYSARIEQLIKPMFDAFTKDSGVAVKFVTDKEGPLLAR 69

Query: 65  RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDT 121
                + +P DV++T D  +L  A  E LL  + + +++      L++  K+   +S   
Sbjct: 70  LKAEGKNTPADVLLTTDAGNLWEAAREGLLRPVESEILETNVPAHLRDPLKRWFGLSIRA 129

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDF 180
           + + Y+T ++K +DL  +   L + +WK RL I  +   +   L+  M     +   +  
Sbjct: 130 RTIVYNTNKVKPSDL-STYEALADPKWKNRLCIRTSKKVYNQSLVAMMIAEHGEPKTEQI 188

Query: 181 IKNITAN 187
           +K    N
Sbjct: 189 VKGWITN 195


>gi|254670777|emb|CBA07081.1| iron transport system substrate-binding protein [Neisseria
           meningitidis alpha153]
          Length = 306

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKISPI--YTSSIQRPPITQGS--PVDVIITKDETSLA 86
           +Y  Q++     +  +F   TG+K+         +      +GS  P DV  ++   +LA
Sbjct: 1   MYNGQHKEAAQAVADAFTRATGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALA 60

Query: 87  --LNEDLLHKLPAHLIK--KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
                +LL  LPA  I   +   V     K  + +S  ++V+ Y T+++   DL KSV +
Sbjct: 61  TLSAANLLEPLPASTINETRGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLN 120

Query: 143 LTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
               +WK R+  AP + +F   +  + +   +     ++K +  
Sbjct: 121 YATPKWKNRIGYAPTSGAFLEQVVAIVKLKGEAAALKWLKGLKE 164


>gi|238021789|ref|ZP_04602215.1| hypothetical protein GCWU000324_01692 [Kingella oralis ATCC 51147]
 gi|237866403|gb|EEP67445.1| hypothetical protein GCWU000324_01692 [Kingella oralis ATCC 51147]
          Length = 331

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           +      +T+Y  Q+      ++ +F + TG+K++       Q       +G  SP DV 
Sbjct: 17  SVPAFADITVYNGQHPEATKALVAAFTQDTGIKVTLNSGKGAQLAGQLKEEGAKSPADVF 76

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL ++PA++I + +   V     K  + +S   +V+ Y   ++  
Sbjct: 77  YTEQTAAFADLSKAGLLAQIPANVIAQTAQKGVPTAAKKDWIALSGRARVVVYDRTKLSE 136

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D PKSV D     WK ++   P + +F   +  + +   +    D++K + A   L  
Sbjct: 137 KDFPKSVLDFATPAWKDKIGYVPTSGAFLEQVVAIVKMKGQKAALDWLKGLKAYGKLYA 195


>gi|74317008|ref|YP_314748.1| ABC transporter iron binding protein [Thiobacillus denitrificans
           ATCC 25259]
 gi|74056503|gb|AAZ96943.1| ABC transporter, iron binding protein [Thiobacillus denitrificans
           ATCC 25259]
          Length = 349

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 89/198 (44%), Gaps = 10/198 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           ++  T LL +     A S     + + +Y+ +N+ ++ P+  ++   TGV++  +     
Sbjct: 14  KSTLTRLLSVVALGLA-SLPALAEEVVVYSARNEQLIKPLFDAYTRETGVQVKFVTDKEG 72

Query: 63  ---IQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +     + +P DV++T D  +L  A  E LL  + +  ++      L++ + +   
Sbjct: 73  PLMARLKAEGKNTPADVLLTVDAGNLWQASEEGLLRPIKSKTLQTNVPAHLRDPDNEWFG 132

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKT 175
           +S   + + Y+T ++K  +L  +  DL N +WK RL +  +   +   L+  M     + 
Sbjct: 133 LSVRARTMVYNTGKVKPGEL-STYEDLANPKWKGRLCLRTSKKVYNQSLVAMMITEYGED 191

Query: 176 VVQDFIKNITANEILTKY 193
             +D ++   AN   + +
Sbjct: 192 KTEDMVRGWVANLATSPF 209


>gi|302036401|ref|YP_003796723.1| putative Fe3+ ABC transporter periplasmic-binding protein
           [Candidatus Nitrospira defluvii]
 gi|300604465|emb|CBK40797.1| ABC transporter, periplasmic binding component, putative Fe3+
           transport system [Candidatus Nitrospira defluvii]
          Length = 343

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 87/185 (47%), Gaps = 9/185 (4%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQG--SPV 74
           A  T    + L +Y+ + + ++ P++  F+ ++G++I  + + + +       +G  +P 
Sbjct: 24  AAGTAEAAEKLVVYSGRAERLIKPVLDEFQAKSGIQIELLSSGTTELVNRLQAEGDHTPA 83

Query: 75  DVIITKDETSL--ALNEDLLHKLP-AHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV +T D  SL  A    LL  +    + +      +  +   + +S    ++ Y+T  +
Sbjct: 84  DVFLTNDAGSLEHARELKLLRPMNMREVERAIPSQFRAADNSWIGLSGRFWIVVYNTNLV 143

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           K   + KS+FDLT  QWK ++++  +   +    ++ ++ T      + F++ + AN   
Sbjct: 144 KPDQI-KSLFDLTQPQWKDKIAVPNSGSEYLQAGVSVIKATFGDERTKQFLQGLKANAGT 202

Query: 191 TKYKR 195
             Y++
Sbjct: 203 QVYQK 207


>gi|6573533|pdb|1D9V|A Chain A, Haemophilus Influenzae Ferric-Binding Protein Apo Form
 gi|157832046|pdb|1MRP|A Chain A, Ferric-Binding Protein From Haemophilus Influenzae
 gi|306991947|pdb|3OD7|A Chain A, Haemophilus Influenzae Ferric Binding Protein A -Iron
           Loaded
 gi|306991948|pdb|3ODB|A Chain A, Haemophilus Influenzae Ferric Binding Protein A -Iron
           Loaded -Open Conformation
          Length = 309

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|145579974|pdb|2O69|A Chain A, Crystal Structure Of Haemophilus Influenzae N193l Mutant
           Fbpa
          Length = 309

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|38492941|pdb|1QW0|A Chain A, Crystal Structure Of Haemophilus Influenzae N175l Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|229845490|ref|ZP_04465619.1| iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 6P18H1]
 gi|619398|gb|AAB32110.1| HitA [Haemophilus influenzae]
 gi|229811593|gb|EEP47293.1| iron(III) ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 6P18H1]
          Length = 332

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAAAAVAKAFEQETGIKVTLNSGKSAQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWVALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|306991649|pdb|3KN8|A Chain A, Crystal Structure Of Haemophilus Influenzae Y196a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|145579973|pdb|2O68|A Chain A, Crystal Structure Of Haemophilus Influenzae Q58l Mutant
           Fbpa
          Length = 309

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTELTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|145579975|pdb|2O6A|A Chain A, Crystal Structure Of The Haemophilus Influenzae E57a
           Mutant Fbpa
          Length = 309

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q++     +  +FE+ TG+K++     S Q       +G  +P DV  T    
Sbjct: 1   DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTAQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|29726721|pdb|1NNF|A Chain A, Crystal Structure Analysis Of Haemophlius Influenzae
           Ferric- Ion Binding Protein H9q Mutant Form
          Length = 309

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q +     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQQKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant
           Holo Ferric Ion-Binding Protein A
          Length = 309

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDET 83
            +T+Y  Q +     +  +FE+ TG+K++     S Q       +G  +P DV  T+   
Sbjct: 1   DITVYNGQAKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTA 60

Query: 84  SLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + A      LL  +    I++ +   V     K  + +S  ++V+ Y   ++   D+ KS
Sbjct: 61  TFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKS 120

Query: 140 VFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
           V D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 173


>gi|294508435|ref|YP_003572493.1| Iron(III)-binding periplasmic protein [Precursor] [Salinibacter
           ruber M8]
 gi|294344763|emb|CBH25541.1| Iron(III)-binding periplasmic protein [Precursor] [Salinibacter
           ruber M8]
          Length = 360

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 81/192 (42%), Gaps = 8/192 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            KR +   L++    +           L +Y+ ++++++  ++  + ++  V +   Y +
Sbjct: 1   MKRLLSLSLVVTLVLSLLGCGGEQQDELVIYSGRSKALVDSLVQQYRQQADVPVRVRYGT 60

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLM 115
             Q       +G  SP DV       +L   +N  LL +LP   +   +      N++  
Sbjct: 61  DSQLLAALQEEGDQSPADVFWANTTGALGNAVNNGLLTELP-DTLANRAARFTPSNQRWT 119

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
            ++   +VLAY++  +   DLP SV DL    +++ R+   P   SF   +  +  T   
Sbjct: 120 PVTTRFRVLAYNSDAVSPEDLPDSVLDLPEHEEFEGRVGWTPAYSSFQDFVTALRVTEGA 179

Query: 175 TVVQDFIKNITA 186
              + ++ ++ A
Sbjct: 180 ETARTWLSDMQA 191


>gi|83816110|ref|YP_446499.1| extracellular solute-binding protein, putative [Salinibacter ruber
           DSM 13855]
 gi|83757504|gb|ABC45617.1| Bacterial extracellular solute-binding protein, putative
           [Salinibacter ruber DSM 13855]
          Length = 363

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 81/192 (42%), Gaps = 8/192 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            KR +   L++    +           L +Y+ ++++++  ++  + ++  V +   Y +
Sbjct: 1   MKRLLSLSLVVTLVLSLLGCGGEQQDELVIYSGRSKALVDSLVQQYRQQADVPVRVRYGT 60

Query: 62  SIQR--PPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLM 115
             Q       +G  SP DV       +L   +N  LL +LP   +   +      N++  
Sbjct: 61  DSQLLAALQEEGDQSPADVFWANTTGALGNAVNNGLLTELP-DTLANRAARFTPSNQRWT 119

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNK 174
            ++   +VLAY++  +   DLP SV DL    +++ R+   P   SF   +  +  T   
Sbjct: 120 PVTTRFRVLAYNSDAVSPEDLPDSVLDLPEHEEFEGRVGWTPAYSSFQDFVTALRVTEGA 179

Query: 175 TVVQDFIKNITA 186
              + ++ ++ A
Sbjct: 180 ETARTWLSDMQA 191


>gi|256396524|ref|YP_003118088.1| extracellular solute-binding protein family 1 [Catenulispora
           acidiphila DSM 44928]
 gi|256362750|gb|ACU76247.1| extracellular solute-binding protein family 1 [Catenulispora
           acidiphila DSM 44928]
          Length = 348

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 11  LLLCGFTEAFSTENTT---KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQR 65
           +  CG + + ++   T   + +T+Y+ Q++  +  ++  FE+RTGVK+       + +  
Sbjct: 21  VAGCGSSASKASAGGTSSGQSITVYSGQHEQTVKALVADFEKRTGVKVELRSGDEAELAN 80

Query: 66  PPITQGS--PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
             + +GS  P DV   ++  +L +   + LL  +    +K       +     + +S   
Sbjct: 81  QLLQEGSASPADVFYAENPPALTMLDEKGLLAPVAPDALKAVPAADSSPKGDWLGVSARA 140

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
                +T        P S+ DL   +WK RL IAP+   F  ++  M         + ++
Sbjct: 141 AAFIAATGSAADTAPPTSLRDLAKPEWKGRLGIAPSETDFAPVITRMIAADGVEATKAWL 200

Query: 182 KNITANEILT 191
             + AN    
Sbjct: 201 VGLKANAKTY 210


>gi|218246285|ref|YP_002371656.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           8801]
 gi|257059332|ref|YP_003137220.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
 gi|218166763|gb|ACK65500.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8801]
 gi|256589498|gb|ACV00385.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
          Length = 365

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 9/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----PPITQGSPVDVIITKDE 82
             L LY+ ++ +    +   F + TG+K++ I     +         + SP D++IT D 
Sbjct: 50  GELNLYSSRHYNTDNELYQGFTQETGIKVNLIEGKDDELIERIQSEGENSPADILITVDV 109

Query: 83  TSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             L  A    +   + + ++ +K    L+         +   +V+ Y+  ++K  DL  +
Sbjct: 110 ARLWRAQEAGIFTPISSPILTEKIPPSLREPEGLWFGFTKRARVIMYNKNKVKPEDL-ST 168

Query: 140 VFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL N +WK R+ + P +N+    L+ ++     +   +++ + + AN
Sbjct: 169 YEDLANPKWKGRIIVRPSSNVYNQSLVASLIVAHGEAKTEEWCRGLVAN 217


>gi|288554838|ref|YP_003426773.1| iron (III) ABC transporter iron (III)-binding protein [Bacillus
           pseudofirmus OF4]
 gi|288545998|gb|ADC49881.1| ABC iron (III) transport system (iron (III)-binding protein)
           [Bacillus pseudofirmus OF4]
          Length = 365

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS-PVDVIITKDE 82
           T  L +Y+ +N++ +  ++  F   TG+++ P++        I    G+   D+ I+ D 
Sbjct: 52  TGELVVYSSRNENFVNALLEKFTADTGIEVKPLHAGDNAVSRIKGEAGNAQADIFISNDV 111

Query: 83  TSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
            +L     E LL       I+      + E+     +S  T+VL Y+   I   ++PKS+
Sbjct: 112 GALENLRLEGLLEGSDPEGIESIDEKYRAEDNSWFALSARTRVLMYNKDLITEEEMPKSI 171

Query: 141 FDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITANEI 189
            DLT+ +W+   +I    N S    ++ +          ++I+ +  N  
Sbjct: 172 EDLTDPKWQGEFAITRGGNGSMIGHVSALRNEWGDDKTIEWIEEVKDNAG 221


>gi|317130158|ref|YP_004096440.1| extracellular solute-binding protein family 1 [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475106|gb|ADU31709.1| extracellular solute-binding protein family 1 [Bacillus
           cellulosilyticus DSM 2522]
          Length = 354

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 76/190 (40%), Gaps = 7/190 (3%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQ 64
           + T LL   G     S  +    L +Y+ +N++ + P++  F E TG+++S ++ +  +Q
Sbjct: 13  VSTGLLATTGCGNDGSAVDGEGELVVYSSRNENFVQPLLDKFTEETGIEVSALHGADPLQ 72

Query: 65  RPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
                     D+ I+ D  +L    NE LL       I       K ++     IS  ++
Sbjct: 73  LQEEAGNVQADIFISNDLGALGYLHNEGLLEGSNPEGIDTIPADFKADDNAYFAISARSR 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKK-RLSIAPN---NISFHRLLNTMEQTPNKTVVQ 178
              Y+   I   ++P S+ DL +A+W       A     N      ++ +          
Sbjct: 133 GFIYNKDLITEEEMPTSIEDLFDAEWANVENGYAITRGGNGGMLGNVSALRYEWGDERTS 192

Query: 179 DFIKNITANE 188
           +++ +I  N 
Sbjct: 193 EWVASIRENA 202


>gi|224826646|ref|ZP_03699747.1| extracellular solute-binding protein family 1 [Lutiella nitroferrum
           2002]
 gi|224601247|gb|EEG07429.1| extracellular solute-binding protein family 1 [Lutiella nitroferrum
           2002]
          Length = 330

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 83/185 (44%), Gaps = 9/185 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---IQRPP 67
           L+      AF+     + + +Y+ + + ++ P+I ++++ TGV +  +       ++R  
Sbjct: 5   LMFAAVLAAFAGSAMAEEIVVYSARAEQLVKPLIEAYKKETGVDVKLVSDKEGPLMERMR 64

Query: 68  IT-QGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
                SP D+++T D  +L  A    LL  + + +++      L++   +   +S   + 
Sbjct: 65  AEGSNSPADILLTVDAGNLWQASKMGLLKPVSSKVLEANIPAHLRDPKNEWFGLSIRART 124

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           L Y+T++++ A L  S  DL + +WK +L +  +   +   L+  +         +  ++
Sbjct: 125 LFYNTQKVQPAQL-SSYEDLADPKWKGKLCLRTSKKVYNQSLVAMLLSEHGPVKTEKIVR 183

Query: 183 NITAN 187
               N
Sbjct: 184 GWVDN 188


>gi|254427272|ref|ZP_05040979.1| Bacterial extracellular solute-binding protein, putative
           [Alcanivorax sp. DG881]
 gi|196193441|gb|EDX88400.1| Bacterial extracellular solute-binding protein, putative
           [Alcanivorax sp. DG881]
          Length = 338

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 42/190 (22%), Positives = 86/190 (45%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS----PIYTS 61
           I    L++       S     + L +YT +N  ++ P+  ++ E TGV+I          
Sbjct: 8   IIVGALVVASGLWGCSEPTADEELVVYTSRNDHLIKPVFDAYTEATGVRIRYITDNASAL 67

Query: 62  SIQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRIS 118
           + +     + SP D++IT D  +L  A  + LL  + + ++K      L +  K+   ++
Sbjct: 68  TARLQAEGERSPADMLITVDAGNLWNAAEKGLLSPVESVVLKNNVPDALTDPKKQWYGLT 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVV 177
              + L YS  R++ ++L  +  DL + +WK RL +  +   +   L+ TM +   +   
Sbjct: 128 VRARTLVYSKDRLQPSEL-STYEDLADPKWKGRLCLRTSKKVYNQSLVATMIERLGEEKA 186

Query: 178 QDFIKNITAN 187
           ++ ++   AN
Sbjct: 187 EEIVRGWVAN 196


>gi|110835458|ref|YP_694317.1| iron ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
 gi|110648569|emb|CAL18045.1| iron ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
          Length = 341

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 86/190 (45%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ- 64
           I    +++       S     + L +YT +N  ++ P+  ++ E TGV+I  I  ++   
Sbjct: 11  IIVGAVIMASGLWGCSEPAADEELVVYTSRNDHLIKPVFDAYTEATGVRIRYITDNAAAL 70

Query: 65  ---RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRIS 118
                   + SP D++IT D  +L  A  + LL  + + ++       L +  K+   ++
Sbjct: 71  TARLQAEGERSPADMLITVDAGNLWNAAEKGLLSPVESEVLSNNVPAALTDPKKQWYGLT 130

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVV 177
              + L YS  RI+ ++L  +  +L + QWK RL +  +   +   L+ TM +   K   
Sbjct: 131 VRARTLVYSRDRIQPSEL-STYENLADPQWKGRLCLRTSKKVYNQSLVATMIERQGKEKT 189

Query: 178 QDFIKNITAN 187
           ++ ++   AN
Sbjct: 190 EEIVRGWVAN 199


>gi|326794001|ref|YP_004311821.1| extracellular solute-binding protein family 1 [Marinomonas
           mediterranea MMB-1]
 gi|326544765|gb|ADZ89985.1| extracellular solute-binding protein family 1 [Marinomonas
           mediterranea MMB-1]
          Length = 354

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 82/192 (42%), Gaps = 11/192 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           R     L  +   +  ++T   +  + +Y+ + ++++ P +  F   TG+ ++ I  S+ 
Sbjct: 16  RLSTIALASVISCSSFYAT--ASDEVNVYSARKEALIKPALDRFSNDTGITVNLITGSAD 73

Query: 64  Q----RPPITQGSPVDVIITKDETSL--ALNEDLLHKL-PAHLIKKNSFVLKNENKKLMR 116
                       SP D+ +T D   L  A +  +L  +  A L       L++ +     
Sbjct: 74  ALLRRLQVEGDASPADLFVTVDAGRLFRAKDAGVLQPIKDAELESAIPANLRDSDDYWFG 133

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKT 175
           +S   +V+ Y+ K+++  +L  +  DL + +WK R+   +  NI    L+ +M     K 
Sbjct: 134 LSQRARVIFYNPKKVEATEL-STYEDLADPKWKGRICTRSSTNIYNQSLVASMIDADGKE 192

Query: 176 VVQDFIKNITAN 187
              ++IK    N
Sbjct: 193 ATLEWIKGFIGN 204


>gi|93006552|ref|YP_580989.1| extracellular solute-binding protein [Psychrobacter cryohalolentis
           K5]
 gi|92394230|gb|ABE75505.1| extracellular solute-binding protein, family 1 [Psychrobacter
           cryohalolentis K5]
          Length = 374

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 78/175 (44%), Gaps = 9/175 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDV 76
           +     + +T+Y+ +N+ ++ P++  + E+TGVK+  +         +     Q +P D+
Sbjct: 59  AASADGQTVTIYSSRNEQLIKPLLDRYTEQTGVKVELVTDKDGPLMARLQAEGQNTPADM 118

Query: 77  IITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L  A  + LL  + + +++       ++   +   +S   + + Y   ++  
Sbjct: 119 LLTVDAGNLWQAAGQGLLQPVASSVLEANVPAKYRDPEGRWTGLSLRARTIFYDPSKVSA 178

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             L  +  DL + +WK +L +  +   +   L+ +M +       +  I+   AN
Sbjct: 179 DQL-STYADLADPKWKGKLCLRTSKKVYNQSLVASMMEHLGAEKTEAVIRGWVAN 232


>gi|152997843|ref|YP_001342678.1| extracellular solute-binding protein [Marinomonas sp. MWYL1]
 gi|150838767|gb|ABR72743.1| extracellular solute-binding protein family 1 [Marinomonas sp.
           MWYL1]
          Length = 347

 Score =  171 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 83/193 (43%), Gaps = 9/193 (4%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           K ++ T          + ++   +  + +Y+ ++++++ P++  + +   VK++ +  S+
Sbjct: 6   KTSLITLASATSLLAFSSTSVQASGEVNIYSARSEALIKPLLDIYAKENNVKVNLVTGSA 65

Query: 63  IQ----RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
                        SP DV IT D   L  A    +L       + K     LK+      
Sbjct: 66  DALLSRLQSEGNASPADVFITVDAGRLYRAKEAGVLQPFETDNLNKVVPEHLKDREGYWY 125

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNK 174
            +S   +V+ Y+ + +  +DL  +  DL + +WK ++ I  + NI    L+ +M     +
Sbjct: 126 GLSLRARVILYNPETVSASDL-STYEDLADPKWKGKICIRSSNNIYNQSLVASMIDANGE 184

Query: 175 TVVQDFIKNITAN 187
               ++IK + AN
Sbjct: 185 KQTLEWIKGLVAN 197


>gi|172037545|ref|YP_001804046.1| iron transport protein [Cyanothece sp. ATCC 51142]
 gi|171698999|gb|ACB51980.1| iron transport protein [Cyanothece sp. ATCC 51142]
          Length = 383

 Score =  171 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 82/179 (45%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGS 72
           T + S   TT  + LY+ ++ +    +   F + TG+K++ +  S+ +         + +
Sbjct: 58  TSSPSATETTGEVNLYSSRHYNTDTELYEGFTQETGIKVNLVEGSADELIERINSEGENT 117

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTK 129
             D+++T D   L  A    +     + +++ +    L+N        +   +V+ Y+  
Sbjct: 118 QADILMTVDVARLWRAEEAGIFAPTTSAILEERVPASLRNPEGLWFGFTKRARVIMYNQD 177

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++   +L  +  DL + +WK R+ I P +NI    L+ ++ +T  +   ++++K   AN
Sbjct: 178 KVNPEEL-STYEDLADPKWKGRIIIRPSSNIYNQSLVASLIETHGEEQTEEWVKGFVAN 235


>gi|87122423|ref|ZP_01078303.1| ABC-type Fe3+ transport system, periplasmic component [Marinomonas
           sp. MED121]
 gi|86162216|gb|EAQ63501.1| ABC-type Fe3+ transport system, periplasmic component [Marinomonas
           sp. MED121]
          Length = 357

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 43/194 (22%), Positives = 86/194 (44%), Gaps = 12/194 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           FK       LL    +         + + +Y+ + ++++ P++  FEE TGV ++ I  S
Sbjct: 18  FKMASILSFLLASSVSLPVMA---DEEVNVYSARKEALIKPMLDRFEEETGVAVNLITGS 74

Query: 62  SIQ----RPPITQGSPVDVIITKDETSL--ALNEDLLHKLP-AHLIKKNSFVLKNENKKL 114
           +           + SP D+ IT D   L  A    +L     A + +     L++ +   
Sbjct: 75  ADALLRRLQVEGEYSPADIFITVDAGRLHRAKQAGVLQPFQTAKIDELVPEHLRDSDDYW 134

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPN 173
             +S  ++ + Y+  R+  ++L  S   L ++QWK R+ +  + NI    L+ +M +   
Sbjct: 135 YSLSQRSRTIFYAKDRVNKSEL-SSYEALADSQWKGRICVRSSGNIYNQSLVASMIEVNG 193

Query: 174 KTVVQDFIKNITAN 187
           +   Q ++K + AN
Sbjct: 194 EDATQTWVKGLMAN 207


>gi|226941550|ref|YP_002796624.1| FbpA [Laribacter hongkongensis HLHK9]
 gi|226716477|gb|ACO75615.1| FbpA [Laribacter hongkongensis HLHK9]
          Length = 332

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 80/178 (44%), Gaps = 9/178 (5%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDVIIT 79
            T + +T+Y+ +N+ ++ P+  ++ + TGV++  I         +     + +P D+++T
Sbjct: 20  ATAEEITVYSARNEQLIKPLFDAYSKETGVQVRFITDKEGPLMARLAAEGKNTPADILMT 79

Query: 80  KDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
            D  +L  A N  LL  + +  +++     L++   +   ++   + + ++T+ +K ADL
Sbjct: 80  VDAGNLWQAANAGLLKPVHSRTLEQNVPAHLRDPKGQWFGLAVRARTIFFNTRTVKPADL 139

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             S   L + +W+ RL +  +   +   L+  M         +  +K    N     +
Sbjct: 140 -SSYEALADPKWRGRLCLRTSKKVYNQSLVGMMMAEHGAAKTEQIVKGWVRNLATAPF 196


>gi|292655852|ref|YP_003535749.1| putative iron-III ABC transporter periplasmic substrate-binding
           protein [Haloferax volcanii DS2]
 gi|291371416|gb|ADE03643.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate iron-III) [Haloferax volcanii DS2]
          Length = 388

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 71/192 (36%), Gaps = 20/192 (10%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPII-------HSFEERTGVKISPIYTSSI-- 63
           + G        + +  LTLY+ + Q+++  +I         F       I P Y S+   
Sbjct: 66  ITGGVSVTEMPDLSGELTLYSGRGQALVGELITFFKEYYDDFT------IRPRYNSAAEL 119

Query: 64  --QRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
             Q     Q SP DV  + +  SL    +      LP+ ++        + + +    S 
Sbjct: 120 VNQIQTEGQNSPADVFFSVNAGSLGALKDAGRTQDLPSEVLDLVRDEFHDPDGQWTGTSG 179

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQ-WKKRLSIAPNNISFHRLLNTMEQTPNKTVVQ 178
             + + ++T +   + +P  +    + + ++  +  AP   SF   +  M     +   +
Sbjct: 180 RARTVPFNTDQFDESGIPDDIMAFPDTEAFRDNIGWAPTYSSFQAFITAMRVLEGEDATR 239

Query: 179 DFIKNITANEIL 190
           ++++ +    + 
Sbjct: 240 EWLQGMQDLGVT 251


>gi|304312061|ref|YP_003811659.1| ABC-type Fe3+ transport system, periplasmic component [gamma
           proteobacterium HdN1]
 gi|301797794|emb|CBL46016.1| ABC-type Fe3+ transport system, periplasmic component [gamma
           proteobacterium HdN1]
          Length = 354

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 75/172 (43%), Gaps = 9/172 (5%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI----QRPPITQGSPVDVIIT 79
                L +Y+ + + ++ P++  F ++TG+ ++ +         +     + +P D++I 
Sbjct: 36  AQAAELNIYSARKEELIRPLLEKFSKKTGIGVNVVTADDDVLIQRLKAEGRNTPADILIM 95

Query: 80  KDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
            D   L  A   DL   + + ++ K     L+  +     ++   +V+AYS +R+K   L
Sbjct: 96  ADAGRLVRAAQADLFQPVKSSILNKNIPAQLRQADGLWFGLTIRARVIAYSPERVKPGTL 155

Query: 137 PKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             S  +L + QWK R+    + N+    L  +M           ++K + AN
Sbjct: 156 -SSYENLADPQWKGRICSRSSGNVYNQSLTASMIANDGAEKTDAWLKGMVAN 206


>gi|145633694|ref|ZP_01789420.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           3655]
 gi|145635495|ref|ZP_01791195.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittAA]
 gi|144985454|gb|EDJ92275.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           3655]
 gi|145267260|gb|EDK07264.1| iron-utilization periplasmic protein hFbpA [Haemophilus influenzae
           PittAA]
          Length = 332

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 78/179 (43%), Gaps = 8/179 (4%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVI 77
           + N+   +T+Y  Q++   + +  +FE+ TG+K++     S Q       +G  +P DV 
Sbjct: 18  SANSFADITVYNGQHKEAAVAVAKAFEQETGIKVTLNSGKSAQLAGQLKEEGDKTPADVF 77

Query: 78  ITKDETSLA--LNEDLLHKLPAHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            T+   + A      LL  +    IK+ +   V     K  + +S  ++V+ Y   ++  
Sbjct: 78  YTEQTATFADLSEAGLLAPISEQTIKQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSE 137

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            D+ KSV D    +WK ++     + +F   +  + +     V  +++K +  N  L  
Sbjct: 138 KDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 196


>gi|30249032|ref|NP_841102.1| solute-binding family 1 protein [Nitrosomonas europaea ATCC 19718]
 gi|30138649|emb|CAD84940.1| Bacterial extracellular solute-binding protein, family 1
           [Nitrosomonas europaea ATCC 19718]
          Length = 343

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 82/185 (44%), Gaps = 9/185 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PI 68
            LL  F  A    +  + + +Y+ + + ++ P+  +F + TG+ +              +
Sbjct: 18  FLLIVFLFAVPISSQAEEIVVYSSRIEQLIKPLFDAFTKETGITVKFTTDKEGALLTRLL 77

Query: 69  TQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
            +G  +P DV+IT D  +L  A    LL  + + +++      L++   +   ++   + 
Sbjct: 78  AEGKRTPADVLITTDAGNLWEAARNGLLKPVTSPVLQANIPENLQDPQGQWFGLTVRART 137

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           + Y+T+++K  +L  +  DL + +WK RL +  +   +   L+  M     +T  +  +K
Sbjct: 138 IVYNTRKVKPEEL-STYADLADPKWKHRLCLRTSKKVYNQSLVAMMIAELGETETERIVK 196

Query: 183 NITAN 187
               N
Sbjct: 197 GWVDN 201


>gi|15613076|ref|NP_241379.1| iron (III) transport system (iron (III)-binding protein) [Bacillus
           halodurans C-125]
 gi|10173126|dbj|BAB04232.1| iron (III) transport system (iron (III)-binding protein) [Bacillus
           halodurans C-125]
          Length = 372

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 75/172 (43%), Gaps = 6/172 (3%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS-PVDVIITKD 81
            T  L +Y+ +N+  +  ++  FE+ TG+ + P++        I    G+   D+ I+ D
Sbjct: 58  GTGELVVYSSRNEDFVNALLEKFEQDTGITVQPLHAGDNAVNRIKGEAGNVQADIFISND 117

Query: 82  ETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             +L     E LL       ++      + E+   + +S  T+VL Y+   I   ++PK+
Sbjct: 118 IGALEHLRLEGLLEGSDPEGVESIDEKYRAEDNSWIALSARTRVLMYNKDLISEEEMPKT 177

Query: 140 VFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           + +LT+ +W+   +I    N      ++ + Q       +++I  +  N   
Sbjct: 178 IEELTDPKWEGDFAITRGGNGGMIAHVSALRQELGDEETKEWISQVKDNAGA 229


>gi|71066102|ref|YP_264829.1| ABC iron transporter, periplasmic binding protein [Psychrobacter
           arcticus 273-4]
 gi|71039087|gb|AAZ19395.1| ABC iron transporter, periplasmic binding protein [Psychrobacter
           arcticus 273-4]
          Length = 374

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 76/175 (43%), Gaps = 9/175 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDV 76
           +     + +T+Y+ +N+ ++ P++  + E+TGVK+  +         +     + +P D+
Sbjct: 59  AASADGQTVTIYSSRNEQLIKPLLDRYTEQTGVKVELVTDKDGPLMARLQAEGKNTPADI 118

Query: 77  IITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D  +L  A  + LL  + + +++       ++       +S   + + Y   ++  
Sbjct: 119 LLTVDAGNLWQATEQGLLQPVASSVLEANVPAKYRDPAGLWTGLSLRARTIFYDPSKVSA 178

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             L  +  DL + +WK +L +  +   +   L+ +M +       +  I+    N
Sbjct: 179 DQL-STYADLADPKWKGKLCLRTSKKVYNQSLVASMMEHLGAEKTEAVIRGWVDN 232


>gi|4514347|dbj|BAA75385.1| Yvfk [Bacillus halodurans]
          Length = 303

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 75/172 (43%), Gaps = 6/172 (3%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI--TQGS-PVDVIITKD 81
            T  L +Y+ +N+  +  ++  FE+ TG+ + P++        I    G+   D+ I+ D
Sbjct: 58  GTGELVVYSSRNEDFVNALLEKFEQDTGITVQPLHAGDNAVNRIKGEAGNVQADIFISND 117

Query: 82  ETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             +L     E LL       ++      + E+   + +S  T+VL Y+   I   ++PK+
Sbjct: 118 IGALEHLRLEGLLEGSDPEGVESIDEKYRAEDNSWIALSARTRVLMYNKDLISEEEMPKT 177

Query: 140 VFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
           + +LT+ +W+   +I    N      ++ + Q       +++I  +  N   
Sbjct: 178 IEELTDPKWEGDFAITRGGNGGMIAHVSALRQELGDEETKEWISQVKDNAGA 229


>gi|225181033|ref|ZP_03734480.1| extracellular solute-binding protein family 1 [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168230|gb|EEG77034.1| extracellular solute-binding protein family 1 [Dethiobacter
           alkaliphilus AHT 1]
          Length = 348

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 73/192 (38%), Gaps = 7/192 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            I T +LL           +  + L +Y+ +N+  +  ++  F E TG+++  ++ ++  
Sbjct: 6   VILTGILLAVSILAFSGCGSAEEQLVVYSGRNERFVQELLDKFTEETGIQVVALHGANAL 65

Query: 65  RPPITQGS-PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDT 121
           +    +G+   DV I+ D  +L     + LL       I       + +N     IS   
Sbjct: 66  QIVEERGNVQADVFISNDLGALGYLDQQGLLQGSEPEGIDTIPAGFRADNNAYFAISVRA 125

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKK-RLSIAPNNISFHRL---LNTMEQTPNKTVV 177
           +   Y+   I   ++PKS+ DL + +W       A        +   ++ +         
Sbjct: 126 RGFIYNKDMITEEEMPKSIEDLFDPKWAGVENGYAITRGGNSGMIGHVSALRYQWGDEKT 185

Query: 178 QDFIKNITANEI 189
            D+I  I  N  
Sbjct: 186 ADWIAAIRENAG 197


>gi|284121617|ref|ZP_06386813.1| iron ABC transporter, periplasmic iron-binding protein [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283829398|gb|EFC33786.1| iron ABC transporter, periplasmic iron-binding protein [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 322

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 76/187 (40%), Gaps = 9/187 (4%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQG--S 72
               S  +    L +Y+ + + ++ P++ +F+  +G+ +  +   S         +G  +
Sbjct: 1   MSLPSWSHAEDSLVVYSGRAERLIQPVLDAFQAESGINVQMLTADSTALINRLQMEGART 60

Query: 73  PVDVIITKDETSLALNEDLLHKLPAH---LIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           P DV+IT D  +L    +L    PA    + +      +  +   + +S    V+ Y+T 
Sbjct: 61  PADVLITNDAGTLERARELQLLQPATIPGIEETIPSRFRAPDNTWIGLSGRIWVIVYNTT 120

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANE 188
            +   D+  S+ DL   +W+ +++I      +    ++ +       V   F++ +  N 
Sbjct: 121 MVGPGDI-SSILDLAEPKWRGKIAIPSAGSVYLQTGVSVIRAVKGDEVTTAFLRGLKDNA 179

Query: 189 ILTKYKR 195
               Y +
Sbjct: 180 GSLVYGK 186


>gi|56750155|ref|YP_170856.1| iron transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81300218|ref|YP_400426.1| iron transport system substrate-binding protein [Synechococcus
           elongatus PCC 7942]
 gi|56685114|dbj|BAD78336.1| iron transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81169099|gb|ABB57439.1| iron transport system substrate-binding protein [Synechococcus
           elongatus PCC 7942]
          Length = 340

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 84/189 (44%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR- 65
                LL     A  +  + K + +Y+ ++ +    +  +F ++TG++++ I     +  
Sbjct: 9   TGLAALLLSTGLAACSGGSDKVVNIYSSRHYNQDDELYKAFTDKTGIQVNVIEGKDAELI 68

Query: 66  ---PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISF 119
                    SP DV+IT D   L  A ++ L   + + ++       L++ + +    + 
Sbjct: 69  ERIQSEGANSPADVLITVDAGRLWQAESKGLFQPVQSSVLTAGLPDDLRDPDGRWFGFAR 128

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+  +++ + L  +   L N +W+ +L +  + NI    L+     T  +   +
Sbjct: 129 RARVIIYNKAKVQPSQL-STYQALANPEWRGKLCMRSSDNIYNQSLVAATIATQGEAATE 187

Query: 179 DFIKNITAN 187
           ++IK +TAN
Sbjct: 188 EWIKGLTAN 196


>gi|332978331|gb|EGK15057.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Psychrobacter sp. 1501(2011)]
          Length = 374

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 79/176 (44%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVD 75
            + + +   +T+Y+ +N+ ++ P++  F + TG+ +  +   S       +     +P D
Sbjct: 54  ATDKASNDTVTIYSSRNEQLIQPLLDEFTKETGIPVELVTDDSGPLMARLEAESTNTPAD 113

Query: 76  VIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           V++T D  +L  A  + LL  + + ++        ++ +     +S   + + Y   +++
Sbjct: 114 VLLTVDAGNLWQAGQQGLLQPIKSEVVNSNVPEKYRSVDDLWTGLSLRARTIFYDPAKVQ 173

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL  +  DL + +WK +L +  +   +   L+ +M +       ++ +K   AN
Sbjct: 174 PTDL-STYADLADPKWKGKLCLRTSKKVYNQSLVASMIEHYGPEKTEEIVKGWVAN 228


>gi|152997755|ref|YP_001342590.1| extracellular solute-binding protein [Marinomonas sp. MWYL1]
 gi|150838679|gb|ABR72655.1| extracellular solute-binding protein family 1 [Marinomonas sp.
           MWYL1]
          Length = 355

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 78/172 (45%), Gaps = 9/172 (5%)

Query: 24  NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIIT 79
                + +Y+ + +S++ P +  F E+  V ++ I  S+             SP D+ IT
Sbjct: 35  QAKGEVNIYSARKESLIKPALDKFSEQNDVVVNLITGSADALLSRLKAEGDASPADIFIT 94

Query: 80  KDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
            D   L  A    +L  + + ++       L++ +     +S   +V+ Y+ +++ + DL
Sbjct: 95  VDAGRLHRAKAAGVLQPIHSDVLSANIPSHLRDSDGYWFGLSQRARVIFYNPEKVSVKDL 154

Query: 137 PKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +  DL + +WK R+ +  + NI    L+ +M +   +   Q +IK + +N
Sbjct: 155 -STYEDLADPKWKGRICVRSSANIYNQSLVASMLEADGREKTQAWIKGLVSN 205


>gi|254415872|ref|ZP_05029629.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
 gi|196177299|gb|EDX72306.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
          Length = 361

 Score =  166 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 78/183 (42%), Gaps = 9/183 (4%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PI 68
                 A         + LY+ ++      + ++F E TG++++ I   + +        
Sbjct: 32  TASTDGAAENTADAGEINLYSARHYDTDDALYNNFTEETGIEVNLIEGDADELIERIKSE 91

Query: 69  TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLA 125
            + SP DV+IT D   L  A  E LL  + +  ++      L++   +   +S   +++ 
Sbjct: 92  GENSPADVLITVDVGRLWRAQEEGLLQPVSSETLEAAVPANLRDPQGEWFGLSKRARIIV 151

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNI 184
           Y+ + ++  +L  +   L   +WK R+ I  + NI    L+ +  +   +   ++++K +
Sbjct: 152 YNKENVQPEEL-STYEALAEPEWKGRVCIRSSENIYNQSLVASKIEGKGEQETENWVKGL 210

Query: 185 TAN 187
             N
Sbjct: 211 VDN 213


>gi|114321721|ref|YP_743404.1| extracellular solute-binding protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114228115|gb|ABI57914.1| extracellular solute-binding protein, family 1 [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 339

 Score =  166 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 81/177 (45%), Gaps = 9/177 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPPITQG--SPV 74
             +T      +T+Y+ + + ++ P+   F E TG+++  +  S+  +      +G  +P 
Sbjct: 22  PATTLADDDTITVYSARQEHLIKPLFDRFTEETGIRVRYVTDSAGPLLARLQQEGRRTPA 81

Query: 75  DVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           D+++T D  +L  A +  +L  + +  + +     L++ + +   +S   + + Y+  R+
Sbjct: 82  DMLMTVDAGNLWQAADRGVLRPIDSEPLREAIPEHLRDPDDQWFGLSVRARTIMYAPDRV 141

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              +L  +   L + +W+ RL +  + ++    L+ TM     +   ++ ++    N
Sbjct: 142 DPEEL-STYEALADPEWEGRLCVRTSQHVYNQSLVATMISHHGEERTREVLEGWVNN 197


>gi|325982326|ref|YP_004294728.1| extracellular solute-binding protein family 1 [Nitrosomonas sp.
           AL212]
 gi|325531845|gb|ADZ26566.1| extracellular solute-binding protein family 1 [Nitrosomonas sp.
           AL212]
          Length = 337

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 81/172 (47%), Gaps = 13/172 (7%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI------TQGSPVDVIIT 79
              + +Y+ + + ++ P+  +F + TG+K+   YT+  +   +       + +P D++IT
Sbjct: 27  ANEVVVYSARIEQLIKPMFDAFTKETGIKVK--YTTDNEGALLARLEAEGKNTPADMLIT 84

Query: 80  KDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADL 136
            D  +L  A  + LL  + + ++++     L++       +S   + L Y+TK++  A+L
Sbjct: 85  ADVGNLWAAAQKGLLKSVESGVLERNIPAHLRDPGNAWFGLSVRARTLVYNTKKVDPAEL 144

Query: 137 PKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +  DL + +W KRL +  +   +   L+  M     +   +  +K   AN
Sbjct: 145 -STYEDLADPKWSKRLCLRTSKKVYNQSLVAMMIAEHGEAETEKIVKGWVAN 195


>gi|148652678|ref|YP_001279771.1| extracellular solute-binding protein [Psychrobacter sp. PRwf-1]
 gi|148571762|gb|ABQ93821.1| extracellular solute-binding protein, family 1 [Psychrobacter sp.
           PRwf-1]
          Length = 372

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 79/179 (44%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGS 72
           +   +     K +T+Y+ +N+ ++ P++  F + TG+ +  +   S     +    +  +
Sbjct: 49  SAEVAPTADAKTVTIYSSRNEQLIQPLLDEFTKETGIPVELVTDDSGPLMARLQAESTNT 108

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTK 129
           P D+++T D  +L  A  + LL  L + ++         + +     +S   + + Y   
Sbjct: 109 PADMLLTVDAGNLWQAAQQGLLQPLNSEVVNSNVPAKYHSVDDLWTGLSLRARTIFYDPA 168

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++  +DL  +  DL + +WK +L +  +   +   L+ +M +       ++ +K   AN
Sbjct: 169 KVNPSDL-STYADLADPKWKGKLCLRTSKKVYNQSLVASMIEHLGAQKTEEIVKGWVAN 226


>gi|121997978|ref|YP_001002765.1| extracellular solute-binding protein [Halorhodospira halophila SL1]
 gi|121589383|gb|ABM61963.1| extracellular solute-binding protein, family 1 [Halorhodospira
           halophila SL1]
          Length = 335

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 83/198 (41%), Gaps = 9/198 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           R I     L+ G       +     LT+Y+ +   ++ PI+  F E TG+ +  +   + 
Sbjct: 3   RPIPVATALIAGAVLITGCDTGDDELTVYSARQDHLISPILERFTEETGISVRFVTDDAG 62

Query: 64  QRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMR 116
                     + +P D+++T D  +L  A   DLL +L +  ++ +    L++ + +   
Sbjct: 63  PLMERLKAEGERTPADILLTVDAGNLHQATENDLLARLDSSELRGRIPEHLRDPDDRWFG 122

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKT 175
           +S   + + YS +R+   +L  S  +L + +W+ RL +  +   +   L+  M     + 
Sbjct: 123 LSVRARTIMYSPERVDPEEL-DSYANLADEKWEGRLCLRTSQQVYNQSLVAMMLHHEGEE 181

Query: 176 VVQDFIKNITANEILTKY 193
                ++    N   + +
Sbjct: 182 ETARIVEGWVDNLATSPF 199


>gi|313126254|ref|YP_004036524.1| ABC Fe3+ transporter, periplasmic component [Halogeometricum
           borinquense DSM 11551]
 gi|312292619|gb|ADQ67079.1| ABC-type Fe3+ transport system, periplasmic component
           [Halogeometricum borinquense DSM 11551]
          Length = 394

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPII----HSFEERTGVKISPIYTSSI----Q 64
           + G        +    LTLY+ + ++++  +I      + + T   + P+Y S+     Q
Sbjct: 71  ISGGVSMAEMPDLEGELTLYSGRGEALVGELISYIEDLYPDFT---VRPLYNSAAELVNQ 127

Query: 65  RPPITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
                Q SP DV  + +  +L   +  +    LP  +++      ++ +   +  S   +
Sbjct: 128 IATEGQNSPADVFYSVNAGALGALKQRERTQSLPQEVLEFVPKSFRDSDGMWVGSSGRAR 187

Query: 123 VLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFI 181
            + Y+T   K +D+P  +    + + ++  L  AP   SF   +  M     +   + ++
Sbjct: 188 SVPYNTNTFKESDIPDDIMSFPDQSNFEGELGWAPTYSSFQAFITAMRILEGEDATRKWL 247

Query: 182 KNITANEILT 191
           K I    +  
Sbjct: 248 KGIQDLGVSQ 257


>gi|126657922|ref|ZP_01729075.1| iron transport protein [Cyanothece sp. CCY0110]
 gi|126620862|gb|EAZ91578.1| iron transport protein [Cyanothece sp. CCY0110]
          Length = 341

 Score =  165 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 79/179 (44%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGS 72
           T +     TT  + LY+ ++ +    +   F + TG+K++ +  S+ +           +
Sbjct: 16  TSSSPATETTGEVNLYSSRHYNTDTELYEGFTQETGIKVNLVEGSADELIERIKSEGDNT 75

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTK 129
             D+++T D   L  A    +     + +++ +    L+N        +   +V+ Y+  
Sbjct: 76  QADILMTVDVARLWRAEEAGIFAPTTSAILEERIPASLRNPEGLWFGFTKRARVIMYNQD 135

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++   +L  +  DL + +WK R+ I P +NI    L+ ++ +   +   ++++K   AN
Sbjct: 136 KVNPEEL-STYEDLADPKWKGRIIIRPSSNIYNQSLVASLIEAHGEEQTEEWVKGFVAN 193


>gi|170079102|ref|YP_001735740.1| iron transport protein [Synechococcus sp. PCC 7002]
 gi|169886771|gb|ACB00485.1| iron transport protein [Synechococcus sp. PCC 7002]
          Length = 363

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 78/179 (43%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGS 72
                +   T  + LY+ ++      +  +F E TG++++ I  S  +         + S
Sbjct: 36  DPGAPSSEATGEINLYSSRHYDSDAELYEAFSEATGIEVNLIEGSDDELLERIRTEGENS 95

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           P DV+IT D   L  A  + LL    + ++       L++ +     ++   +++ Y+T+
Sbjct: 96  PADVLITVDVARLWRAQQDGLLQPTESEVLTSAIPENLRSSDNTWFGLTKRARIIVYNTE 155

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +  A+L  +  DL + +W+ R+ + + +N     L+            +++++ + AN
Sbjct: 156 TVDPAEL-STYEDLADPKWEGRVCVRSSSNTYNQSLVAAKIVEKGAEATEEWVQGLVAN 213


>gi|320162372|ref|YP_004175597.1| ABC transporter substrate binding protein [Anaerolinea thermophila
           UNI-1]
 gi|319996226|dbj|BAJ64997.1| ABC transporter substrate binding protein [Anaerolinea thermophila
           UNI-1]
          Length = 378

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 78/179 (43%), Gaps = 8/179 (4%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEE---RTGVKISPIYTSSIQRPPITQGS--PV 74
            + E     L +Y+ ++++++ P++ +F        + +     S I    I + S    
Sbjct: 62  SAAETVGGKLVIYSGRSEALIQPVLDAFRALYPNVEIALKAGSNSEIANALIEEQSNPQA 121

Query: 75  DVIITKDE-TSLALNE-DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DV IT +  T+  L+E  +L               +  +   + ++   +V+ Y+T  + 
Sbjct: 122 DVFITTEVFTAQKLSENGVLAPYTPAQPDLLPADGRAADGTWVALTRRARVILYNTNLVP 181

Query: 133 IADLPKSVFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITANEIL 190
             +LP S+FDLT+ +WK +++ A   N S    +  M     +   + ++K +  NE+ 
Sbjct: 182 PEELPASIFDLTDPKWKGQVAAANSTNGSMQAQIAVMRHLYGEETTEAWLKGLMDNEVT 240


>gi|254491495|ref|ZP_05104674.1| Bacterial extracellular solute-binding protein, putative
           [Methylophaga thiooxidans DMS010]
 gi|224462973|gb|EEF79243.1| Bacterial extracellular solute-binding protein, putative
           [Methylophaga thiooxydans DMS010]
          Length = 343

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 88/192 (45%), Gaps = 9/192 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           ++ +T +  L G           + + LY+ + +S++ P+++ F + TG+K++ +   + 
Sbjct: 5   KSFFTLIPALLGLGMTPGISQAAEEVNLYSARMESLIKPLLNQFTQDTGIKVNVVSGKAD 64

Query: 64  QRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMR 116
           +         + SP D+++T D   L  AL  +LL  + + ++ ++     ++       
Sbjct: 65  ELLQRLKLEGRNSPADMLLTTDAGRLHRALEAELLQTVSSDILNERVPSSYRDPEGHWYG 124

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKT 175
           +S   + + Y+  R+    L  +   L + +W  ++ I + +NI    L+ +M     + 
Sbjct: 125 LSLRARPIMYAVDRVNPEQL-STYEQLASDEWDNKICIRSSSNIYNQSLVASMIAADGED 183

Query: 176 VVQDFIKNITAN 187
             Q + +N+ AN
Sbjct: 184 TTQAWAENLVAN 195


>gi|254422073|ref|ZP_05035791.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
 gi|196189562|gb|EDX84526.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
          Length = 346

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 83/188 (44%), Gaps = 10/188 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLT-LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR-- 65
            LL+  G T    + +  + +  LY+ ++  V   +   F E+TG++++ +     +   
Sbjct: 12  TLLVGLGITACQGSSDQAEQVVNLYSARHYDVDEELYEEFTEQTGIQVNVLEGKPDELIE 71

Query: 66  --PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFD 120
                 + SP DV I  D   L  A    +L  + + ++       L+  +     ++  
Sbjct: 72  RISNEGEESPADVFIAVDAGRLWRAQEAGILQPVSSEVLNSVVPENLREPSGLWYGLTTR 131

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQD 179
            ++L Y+T  ++  +L  +  DL + +W++R+ I  + N+    LL +M ++      + 
Sbjct: 132 ARMLVYNTDNVQPEEL-STYEDLADPKWEERVCIRSSENVYNQSLLGSMVESIGPEATET 190

Query: 180 FIKNITAN 187
           + + + +N
Sbjct: 191 WAEGLVSN 198


>gi|85713064|ref|ZP_01044100.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           baltica OS145]
 gi|85693103|gb|EAQ31065.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           baltica OS145]
          Length = 344

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 32/195 (16%), Positives = 83/195 (42%), Gaps = 9/195 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           +   +  +   +    +      + +Y+ + Q+++ P++  F E+TG++++ +  +S   
Sbjct: 8   LKLAMAAIISASTLAGSFAQAAEVNIYSSRKQALIKPLLDKFTEQTGIEVNLLTGNSDAL 67

Query: 66  P----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRIS 118
                   + +P D+ +T D  +L  A+  D+   + +    K      ++ + + + +S
Sbjct: 68  LSRLKAEGENTPADLFLTVDAGALHRAVTADVFQAIDSEFAHKTVPAHFRDSDDQWVGLS 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVV 177
              + + YS  R+  + L      L + QW+ R+ I  + NI    L+  +     +  +
Sbjct: 128 LRARPIFYSPDRVDPSQLEN-YMSLADDQWQDRICIRSSNNIYNQSLVAALLDHYGEQKI 186

Query: 178 QDFIKNITANEILTK 192
             + K++  N   T 
Sbjct: 187 MGWAKDLVDNFARTP 201


>gi|222474784|ref|YP_002563199.1| iron binding protein FbpA precursor (fpbA) [Anaplasma marginale
           str. Florida]
 gi|222418920|gb|ACM48943.1| iron binding protein FbpA precursor (fpbA) [Anaplasma marginale
           str. Florida]
          Length = 356

 Score =  163 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 81/189 (42%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              + L  GF          + + +Y+ + + ++  +   F   TG+K+  I   + Q  
Sbjct: 20  ALAVGLGIGFLYDRYQSGQGEVVNVYSSRKEELLRDLFRKFTAETGIKVQYINDEAAQLI 79

Query: 67  PITQG----SPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISF 119
              +     S  DV +T D  +L L +   LL  + ++++++      ++       ++ 
Sbjct: 80  ARMESEGMYSKADVFLTADAVNLILAKKRGLLQAVRSNVLEQVIPARYRDAEGYWFGLTK 139

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+   + + DL  +  DL N +W+ ++ + + ++     L+  M  +      +
Sbjct: 140 RARVMVYNKALVDVGDL-STYEDLANPKWRGKILVRSSSSPYNQSLIAFMIASNGSEATR 198

Query: 179 DFIKNITAN 187
           ++++ + AN
Sbjct: 199 EWVRGLVAN 207


>gi|119490211|ref|ZP_01622724.1| iron binding protein component of ABC iron transporter [Lyngbya sp.
           PCC 8106]
 gi|119454097|gb|EAW35250.1| iron binding protein component of ABC iron transporter [Lyngbya sp.
           PCC 8106]
          Length = 350

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/189 (18%), Positives = 77/189 (40%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
               + L        +      + LY+ ++      + + F ++TG+K++ +   + Q  
Sbjct: 15  AFATVTLGELLNKRGSFADPGTINLYSSRHYDTDNQLYNGFTQKTGIKVNLVEGDAAQLI 74

Query: 67  ----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISF 119
                    SP DV+IT D  +L  A  E +   + + ++       L++   +   +S 
Sbjct: 75  ERIKSEGANSPADVLITVDAGNLWRAQQEGIFQPVSSSVLNNAIPANLRDPENRWFGLSK 134

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+   +  A L  S  DL + +WK ++ I  + NI    L+ ++ +       +
Sbjct: 135 RARVIMYNKNNVNPAQL-SSYEDLADPKWKGKVVIRSSNNIYNQSLVASLLEVHGAADTE 193

Query: 179 DFIKNITAN 187
            + K   +N
Sbjct: 194 KWAKGFVSN 202


>gi|258593641|emb|CBE69982.1| Iron(III) ABC transporter iron (III)-binding protein [NC10
           bacterium 'Dutch sediment']
          Length = 334

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 87/191 (45%), Gaps = 12/191 (6%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI--SPIYTSSI 63
           +   LL +C    A ++E     L +Y+ + +S + P++  FE  TG+K+      TS +
Sbjct: 14  VLATLLFVCVDASASASE-----LVIYSGRKESAIKPVVDLFERETGIKVALKVGKTSGL 68

Query: 64  QRPPITQGSP--VDVIITKDET--SLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISF 119
               + +      D++I  +     + + E LL    +   +      K+       IS 
Sbjct: 69  ANEILQERQRPRADILIATEAGICEILVREGLLEPYVSPGARAIPAEHKSSRGLWTGISG 128

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNI-SFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+T  +K  D+P SV DLT+A+WK +++IA     +    L+ + Q  ++   +
Sbjct: 129 RARVIIYNTDLVKGGDIPNSVLDLTDAKWKGKIAIAGTRERTTLSWLSALVQVMSEAKAK 188

Query: 179 DFIKNITANEI 189
            +I  +  N +
Sbjct: 189 TYIDKLMENGL 199


>gi|16329434|ref|NP_440162.1| iron transport protein [Synechocystis sp. PCC 6803]
 gi|81670293|sp|P72827|FUTA1_SYNY3 RecName: Full=Iron uptake protein A1; Flags: Precursor
 gi|1651916|dbj|BAA16842.1| iron transport protein [Synechocystis sp. PCC 6803]
          Length = 360

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 81/197 (41%), Gaps = 12/197 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFS---TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           F   + + LL  CG +       T    + + LY+ ++ +    +   F   TG+K++ I
Sbjct: 17  FTVVVGSQLLSSCGQSPDAPIADTPGEQQEINLYSSRHYNTDNELYAKFTAETGIKVNLI 76

Query: 59  YTSSIQRP----PITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVL-KNEN 111
              + +           SP DV++T D   L   E   +   + + +++ N     ++ +
Sbjct: 77  EGKADELLERIKSEGANSPADVLLTVDLARLWRAEEDGIFQPVQSEILETNVPEYLRSPD 136

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQ 170
                 +   +V+ Y+  ++K  +L  +  +L + +WK R+ I + +N     L+ ++  
Sbjct: 137 GMWFGFTKRARVIMYNKGKVKPEEL-STYEELADPKWKGRVIIRSSSNEYNQSLVASLVV 195

Query: 171 TPNKTVVQDFIKNITAN 187
              +     + K   +N
Sbjct: 196 ADGEESTLAWAKGFVSN 212


>gi|91217373|ref|ZP_01254333.1| ferric iron uptake ABC transporter (FeT) family, substrate binding
           protein [Psychroflexus torquis ATCC 700755]
 gi|91184481|gb|EAS70864.1| ferric iron uptake ABC transporter (FeT) family, substrate binding
           protein [Psychroflexus torquis ATCC 700755]
          Length = 342

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 91/192 (47%), Gaps = 12/192 (6%)

Query: 7   YTYLLLLCGFTEAFSTENTTK---YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           Y Y +++  F     +E   +    LT+YT ++      +   FE++  +K++ +  S+ 
Sbjct: 4   YFYAIIMVAFVLGCKSEPKEEKVEELTVYTHRHYESDQALFKLFEKQNDIKLNVVNASAD 63

Query: 64  QRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
           +         + SP DV+IT D   L  A +E LL  +   LI       L++ +K+ + 
Sbjct: 64  ELIQKMKLEGKQSPADVLITVDAGRLYRAKSEGLLQPISNSLIDSIVPANLRDTDKQWVG 123

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKT 175
           ++   +V+ YS  R+   DL  +  DLT+ +WK ++ + + +NI    LL ++    +K 
Sbjct: 124 LTKRARVIVYSKDRVDPNDL-STYEDLTSEKWKNKILVRSSSNIYNQSLLASLISNQSKD 182

Query: 176 VVQDFIKNITAN 187
             +++   +  N
Sbjct: 183 FAEEWANGLVEN 194


>gi|56416415|ref|YP_153489.1| iron binding protein FbpA precursor [Anaplasma marginale str. St.
           Maries]
 gi|254994644|ref|ZP_05276834.1| iron binding protein FbpA precursor [Anaplasma marginale str.
           Mississippi]
 gi|255002753|ref|ZP_05277717.1| iron binding protein FbpA precursor [Anaplasma marginale str.
           Puerto Rico]
 gi|255003885|ref|ZP_05278686.1| iron binding protein FbpA precursor [Anaplasma marginale str.
           Virginia]
 gi|56387647|gb|AAV86234.1| iron binding protein FbpA precursor [Anaplasma marginale str. St.
           Maries]
          Length = 346

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 81/189 (42%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              + L  GF          + + +Y+ + + ++  +   F   TG+K+  I   + Q  
Sbjct: 10  ALAVGLGIGFLYDRYQSGQGEVVNVYSSRKEELLRDLFRKFTAETGIKVQYINDEAAQLI 69

Query: 67  PITQG----SPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISF 119
              +     S  DV +T D  +L L +   LL  + ++++++      ++       ++ 
Sbjct: 70  ARMESEGMYSKADVFLTADAVNLILAKKRGLLQAVRSNVLEQVIPARYRDAEGYWFGLTK 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+   + + DL  +  DL N +W+ ++ + + ++     L+  M  +      +
Sbjct: 130 RARVMVYNKALVDVGDL-STYEDLANPKWRGKILVRSSSSPYNQSLIAFMIASNGSEATR 188

Query: 179 DFIKNITAN 187
           ++++ + AN
Sbjct: 189 EWVRGLVAN 197


>gi|56460167|ref|YP_155448.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           loihiensis L2TR]
 gi|56179177|gb|AAV81899.1| ABC-type Fe3+ transport system, periplasmic component [Idiomarina
           loihiensis L2TR]
          Length = 341

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 78/194 (40%), Gaps = 9/194 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            ++      +         S  +    + +Y+ + ++++ P++  F E TG++++ +   
Sbjct: 1   MRKFHSLLAIFAATSATLVSFTSAAAEVNIYSARKEALIKPVLEKFTEETGIEVNLLTGK 60

Query: 62  SIQRPP----ITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKL 114
           +           + +P D+ +T D  +L  A+  D    + +  I        ++ +   
Sbjct: 61  ADALLARLNSEGKNTPADLFLTVDAGALHRAVQADAFQAVSSDEINSAVPSHFRSTDNLW 120

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNI-SFHRLLNTMEQTPN 173
             +S   + + YS +R+   +L  S   L + +W  R+ I  +N      L+  + +   
Sbjct: 121 FGLSLRARPIFYSPERVNPDELE-SYLSLADDKWSDRICIRSSNNLYNQSLVAALIEHHG 179

Query: 174 KTVVQDFIKNITAN 187
               +++ ++  AN
Sbjct: 180 AEKTEEWAEDFVAN 193


>gi|110632532|ref|YP_672740.1| extracellular solute-binding protein [Mesorhizobium sp. BNC1]
 gi|110283516|gb|ABG61575.1| extracellular solute-binding protein, family 1 [Chelativorans sp.
           BNC1]
          Length = 349

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 77/188 (40%), Gaps = 9/188 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISP---IYTSSI 63
              L L+ G +   S       + +YT +   ++ P++ +F E TG+             
Sbjct: 10  LAALALMAGTSLLPSAAQADGVVNVYTYREPGLIQPLLDAFTEETGIATEVLFLNQGLED 69

Query: 64  QRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFD 120
           +     Q SP DV++T D   L     + +   +   +I        ++       ++  
Sbjct: 70  RIAAEGQNSPADVVLTVDIGRLVNVKEKGVTQPVDDEVINANIPAEFRDPEGHWFGLTTR 129

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
            +V+  S +R++  ++  +  +L + +WK ++ +      ++  L+ +M     +   ++
Sbjct: 130 GRVIYASKERVQQDEI--TYEELADPKWKGKICMRSGQHMYNIALIASMIAHHGEEKAEE 187

Query: 180 FIKNITAN 187
           ++K + AN
Sbjct: 188 WLKGVKAN 195


>gi|326573091|gb|EGE23064.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis CO72]
          Length = 331

 Score =  161 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 81/191 (42%), Gaps = 9/191 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---- 66
           L++     A +       + +Y+ +   ++ PI  +++++TG K++ +   +        
Sbjct: 4   LVMAALVMATAAPAFANEIVVYSARADELLKPIAEAYQQKTGTKVTVVSDKAGPLMERLK 63

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
              + +  DV+IT D  +L  A    +L  + + ++K      L++       +S   + 
Sbjct: 64  AEGKNTQADVLITVDGGNLWQATQAGVLRPINSSVLKSNIPSHLRDPKNHWFGLSVRART 123

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           + Y+  ++  ++L  +  DL + +WK RL +  +N  +   L+ TM     +      +K
Sbjct: 124 IFYNPNKVNPSEL-STYADLADPKWKGRLCLRTSNNVYNQSLVATMIANHGQAATDRVVK 182

Query: 183 NITANEILTKY 193
              AN     +
Sbjct: 183 GWVANLAAAPF 193


>gi|89095389|ref|ZP_01168304.1| ABC-type Fe3+ transport system, periplasmic component
           [Oceanospirillum sp. MED92]
 gi|89080357|gb|EAR59614.1| ABC-type Fe3+ transport system, periplasmic component
           [Oceanospirillum sp. MED92]
          Length = 338

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 80/191 (41%), Gaps = 10/191 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLT-LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           + +  L+        S       L  +Y+ + ++++ P++  F E+TG+ ++ +   +  
Sbjct: 1   VGSVALVSVASLLPTSVFAEEAGLVNVYSARKEALIKPMLERFTEQTGITVNLVTGKADA 60

Query: 65  RPPITQ----GSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
                +     SP D+ +T D   L  A    +L    +  + K     LK+ +     +
Sbjct: 61  LLKRLEVEGSASPADLFVTVDAGRLHRAKEAGVLQVSGSKTLNKAIPASLKDADGYWYGM 120

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTV 176
           +   + + Y   ++  ++L  +  DL + +WK R+ + + +NI    L+ +M     +  
Sbjct: 121 TQRARTVFYVKGKVDPSEL-STYEDLADPKWKGRICVRSSSNIYNQSLVASMIDAIGEEK 179

Query: 177 VQDFIKNITAN 187
            + + K +  N
Sbjct: 180 TEAWAKGLVKN 190


>gi|209884262|ref|YP_002288119.1| extracellular solute-binding protein, family 1 [Oligotropha
           carboxidovorans OM5]
 gi|209872458|gb|ACI92254.1| extracellular solute-binding protein, family 1 [Oligotropha
           carboxidovorans OM5]
          Length = 343

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 87/195 (44%), Gaps = 10/195 (5%)

Query: 1   MFKRTIYTYLLLLCGFT-EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
           M  R     +L+ C     A      +  + +Y+ +   ++ P+  +F + TG+K++ + 
Sbjct: 3   MSNRLPARAVLMSCAILFSAAPALAQSGEVNVYSYRETKLVQPLFDAFTKDTGIKVNVVS 62

Query: 60  TSS-IQRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKK 113
            SS +++   ++G  SP DV++T D   +  A+   +   + + ++        ++ +  
Sbjct: 63  ASSGLEQRIKSEGANSPADVMLTVDIGRIDEAVAAGISQPIKSEVVNSTVPAQYRDPSDN 122

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTP 172
              IS   +V+  S  R+K   +  +  +L + +WK ++ I    +I  + L        
Sbjct: 123 WTGISMRARVIYASKDRVKQEAI--TYEELADPKWKGKICIRSGQHIYNNALFAAYLAHH 180

Query: 173 NKTVVQDFIKNITAN 187
            +   +++++ + AN
Sbjct: 181 GEAKTEEWLRGLKAN 195


>gi|300866641|ref|ZP_07111328.1| Iron deficiency-induced protein A [Oscillatoria sp. PCC 6506]
 gi|300335350|emb|CBN56488.1| Iron deficiency-induced protein A [Oscillatoria sp. PCC 6506]
          Length = 349

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 77/189 (40%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              ++ +   ++          L LY+ ++      +  SF ++TG+K++ +   + Q  
Sbjct: 14  AMAVVAMGELSKTAPVAAQAGTLNLYSARHYDTDNALYQSFTKKTGIKVNLVEADADQLI 73

Query: 67  ----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISF 119
                    SP DV IT D   L  A    +L  + + ++       L++       +S 
Sbjct: 74  ERIKSEGANSPADVFITVDGGRLWRAKQAGILQPVSSRVLTSAIPGSLRDPQGFWFGLSR 133

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+  ++  A L  +   LT+ +WK ++ + +  NI    L+ ++         +
Sbjct: 134 RARVIVYNKSKVNPAQL-STYEALTDPRWKGKILVRSSTNIYNQSLVGSILAAHGGQKTE 192

Query: 179 DFIKNITAN 187
            + + + AN
Sbjct: 193 AWARGLVAN 201


>gi|242281008|ref|YP_002993137.1| extracellular solute-binding protein family 1 [Desulfovibrio
           salexigens DSM 2638]
 gi|242123902|gb|ACS81598.1| extracellular solute-binding protein family 1 [Desulfovibrio
           salexigens DSM 2638]
          Length = 333

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 82/195 (42%), Gaps = 9/195 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              L +      A+S       + +Y+ + + ++ P+  ++   TGVK+  I   +    
Sbjct: 4   LITLAITAIMVAAWSAAAFATEVVVYSARKEHLIKPLFDAYTAETGVKVKYITGKAGALL 63

Query: 67  ----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISF 119
                    +P D+ IT D  +L  A NE +L  + +  ++K     L++   +   +S 
Sbjct: 64  ERIKAEGANTPADLFITVDAGNLWHAANEGVLAPVKSETLEKNVPAHLRDPENRWAGLSV 123

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQ 178
             + + Y+  ++   +L  +   L +++WK RL +  +   +   L+ +      +   +
Sbjct: 124 RARTIVYNKDKVSPEEL-STYEALGDSKWKGRLLLRTSKKVYNQSLVASFIAEKGEAETE 182

Query: 179 DFIKNITANEILTKY 193
           + +K+  AN  +  +
Sbjct: 183 NIVKSWVANLPVVPF 197


>gi|269958297|ref|YP_003328084.1| putative ABC-type Fe3+ transport system protein [Anaplasma centrale
           str. Israel]
 gi|269848126|gb|ACZ48770.1| putative ABC-type Fe3+ transport system protein [Anaplasma centrale
           str. Israel]
          Length = 346

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 79/189 (41%), Gaps = 9/189 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              L L  GF       +  + + +Y+ + + ++  +   F   TG+K+  I   + Q  
Sbjct: 10  ALVLGLGIGFLYDRYQSDRGEVVNVYSSRKEELLRDLFRKFTAETGIKVRYINDEAAQLI 69

Query: 67  PITQG----SPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISF 119
              +     S  DV +T D  +L L +   LL  + + ++++      ++       ++ 
Sbjct: 70  ARMESEGVYSKADVFLTADAVNLILAKKRGLLQTVRSDVLEQVIPARYRDVEGYWFGLTK 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V+ Y+   + + DL  +  DL + +W+ ++ + + ++     L+  M         +
Sbjct: 130 RARVVVYNKALVNVEDL-STYEDLADPKWRGKILVRSSSSPYNQSLIAFMVANNGSAATR 188

Query: 179 DFIKNITAN 187
            +++ + AN
Sbjct: 189 AWVRGLVAN 197


>gi|326561557|gb|EGE11900.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis 7169]
 gi|326564840|gb|EGE15048.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis 12P80B1]
 gi|326568027|gb|EGE18119.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis BC7]
 gi|326570669|gb|EGE20703.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis BC1]
 gi|326571225|gb|EGE21248.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis BC8]
 gi|326577795|gb|EGE27667.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis O35E]
          Length = 331

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 81/191 (42%), Gaps = 9/191 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---- 66
           L++     A +       + +Y+ +   ++ PI  +++++TG K++ +   +        
Sbjct: 4   LVMAALVMATAAPAFANEIVVYSARADELLKPIAEAYQQKTGTKVTVVSDKAGPLMERLK 63

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
              + +  DV+IT D  +L  A    +L  + + ++K      L++       +S   + 
Sbjct: 64  AEGKNTQADVLITVDGGNLWQATQAGVLRPINSSVLKSNIPSHLRDPKNHWFGLSVRART 123

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           + Y+  ++  ++L  +  DL + +WK RL +  +N  +   L+ TM     +      +K
Sbjct: 124 IFYNPNKVNPSEL-STYADLADPKWKGRLCLRTSNNVYNQSLVATMIANHGQATTDRVVK 182

Query: 183 NITANEILTKY 193
              AN     +
Sbjct: 183 GWVANLAAAPF 193


>gi|1573048|gb|AAC21773.1| iron(III) ABC transporter, periplasmic-binding protein (hitA)
           [Haemophilus influenzae Rd KW20]
          Length = 294

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 67/158 (42%), Gaps = 8/158 (5%)

Query: 43  IIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDETSLA--LNEDLLHKLP 96
           +  +FE+ TG+K++     S Q       +G  +P DV  T+   + A      LL  + 
Sbjct: 1   MAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPIS 60

Query: 97  AHLIKKNS--FVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI 154
              I++ +   V     K  + +S  ++V+ Y   ++   D+ KSV D    +WK ++  
Sbjct: 61  EQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGY 120

Query: 155 APNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
              + +F   +  + +     V  +++K +  N  L  
Sbjct: 121 VSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYA 158


>gi|284929118|ref|YP_003421640.1| Fe3+ ABC transporter periplasmic protein [cyanobacterium UCYN-A]
 gi|284809577|gb|ADB95282.1| ABC-type Fe3+ transport system, periplasmic component
           [cyanobacterium UCYN-A]
          Length = 359

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 87/209 (41%), Gaps = 24/209 (11%)

Query: 2   FKRTIYTYLLLLCGFTEAFS---------------TENTTKYLTLYTDQNQSVMLPIIHS 46
           F R ++   L       A                 ++ +   + LY+ ++ +    +   
Sbjct: 4   FSRRLFLSGLTTLAVISAMQITTSCSDKGKISNNLSDKSLGEVNLYSSRHYNTDTELYEG 63

Query: 47  FEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI 100
           F + TG++++ +  S+ +         + +  DV +T D   L  A   ++   + + ++
Sbjct: 64  FTKETGIQVNLVEGSADELIERIRSEGENTKADVFMTVDVGRLWRAQKTNIFMPISSPIL 123

Query: 101 K-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAP-NN 158
           + +    L+ +N      +  ++V+ Y+  ++K  +L  +   L + +WK R+ I P +N
Sbjct: 124 EERIPAPLREKNGYWFGFTKRSRVIVYNKSKVKPEEL-STYESLADTKWKDRIIIRPSSN 182

Query: 159 ISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           I    L+ ++ +   +   + +++   AN
Sbjct: 183 IYNQSLVASLIEANGEEATEKWVRGFVAN 211


>gi|110668454|ref|YP_658265.1| ABC-type iron(III) transport system,substrate-binding protein
           [Haloquadratum walsbyi DSM 16790]
 gi|109626201|emb|CAJ52657.1| ABC-type iron(III) transport system,substrate-binding protein
           [Haloquadratum walsbyi DSM 16790]
          Length = 401

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 26/170 (15%), Positives = 68/170 (40%), Gaps = 10/170 (5%)

Query: 26  TKYLTLYTDQNQSVMLPII----HSFEERTGVKISPIYTSSIQRPPITQG--SPVDVIIT 79
              LT+Y+ + ++++  ++      + E T ++      S +    IT+G  SP DV  +
Sbjct: 91  AGELTVYSGRGEALVGELLSFIEDRYPELT-IRPLYNSASELVNQIITEGQNSPGDVFYS 149

Query: 80  KDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
            +  SL      +    L    +       ++ +   +  S   + + Y+T  +  + +P
Sbjct: 150 VNAGSLGALATRERTQSLSDETLSLVPEAFQSPDGSWVGTSGRARAIPYNTDILTESSIP 209

Query: 138 KSVFDLTN-AQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
            ++    +  ++  +L  AP   SF   +  M     ++  + +++ +  
Sbjct: 210 TNIMSFPDTTEFDGQLGWAPTYSSFQAFITAMRLLEGESDTRQWLRGMQE 259


>gi|296112522|ref|YP_003626460.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis RH4]
 gi|295920216|gb|ADG60567.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis RH4]
          Length = 326

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 79/189 (41%), Gaps = 9/189 (4%)

Query: 13  LCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PI 68
           +     A +       + +Y+ +   ++ PI  +++++TG K++ +   +          
Sbjct: 1   MAALVMATAAPAFANEIVVYSARADELLKPIAEAYQQKTGTKVTVVSDKAGPLMERLKAE 60

Query: 69  TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLA 125
            + +  DV+IT D  +L  A    +L  + + ++K      L++       +S   + + 
Sbjct: 61  GKNTQADVLITVDGGNLWQATQAGVLRPINSSVLKSNIPSHLRDPKNHWFGLSVRARTIF 120

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNI 184
           Y+  ++  ++L  +  DL + +WK RL +  +N  +   L+ TM     +      +K  
Sbjct: 121 YNPNKVNPSEL-STYADLADPKWKGRLCLRTSNNVYNQSLVATMIANHGQAATDRVVKGW 179

Query: 185 TANEILTKY 193
            AN     +
Sbjct: 180 VANLAAAPF 188


>gi|85703671|ref|ZP_01034775.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
 gi|85672599|gb|EAQ27456.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
          Length = 338

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 85/177 (48%), Gaps = 10/177 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPV 74
           A +     + + LY+ ++      +  +F E TG+KI+ I     +           SP 
Sbjct: 15  ALTAPALAQEVNLYSSRHYDSDNALYDAFTEETGIKINRIEGKEAELIERMKAEGANSPA 74

Query: 75  DVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV +T D  ++  A++E LL    + LI+   +  L++ +     +S  ++++ Y+  R+
Sbjct: 75  DVFMTVDVGNISRAVDEGLLQPFDSDLIETNVAANLRHPDNLWTGLSQRSRIIFYAKDRV 134

Query: 132 KIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
                P++  +L + ++K ++ I + +N+    LL ++ +   + V +D+ + I AN
Sbjct: 135 DA--PPQTYEELADPKYKGQICIRSSSNVYNQSLLASIIEVHGEEVAKDWAEGIVAN 189


>gi|152149368|pdb|2PT1|A Chain A, Futa1 Synechocystis Pcc 6803
 gi|152149369|pdb|2PT2|A Chain A, Structure Of Futa1 With Iron(Ii)
 gi|215261405|pdb|3F11|A Chain A, Structure Of Futa1 With Iron(Iii)
          Length = 334

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T    + + LY+ ++ +    +   F   TG+K++ I   + +           SP D
Sbjct: 12  ADTPGEQQEINLYSSRHYNTDNELYAKFTAETGIKVNLIEGKADELLERIKSEGANSPAD 71

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKKNSFVL-KNENKKLMRISFDTQVLAYSTKRIK 132
           V++T D   L   E   +   + + +++ N     ++ +      +   +V+ Y+  ++K
Sbjct: 72  VLLTVDLARLWRAEEDGIFQPVQSEILETNVPEYLRSPDGMWFGFTKRARVIMYNKGKVK 131

Query: 133 IADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +  +L + +WK R+ I + +N     L+ ++     +     + K   +N
Sbjct: 132 PEEL-STYEELADPKWKGRVIIRSSSNEYNQSLVASLVVADGEESTLAWAKGFVSN 186


>gi|34497363|ref|NP_901578.1| ABC transporter, iron binding protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34103219|gb|AAQ59582.1| ABC transporter, iron binding protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 330

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 77/175 (44%), Gaps = 9/175 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDE 82
           + + +Y+ + + ++ PI+ ++++ TGV +  +               + SP D+++T D 
Sbjct: 21  EEVVVYSARGEQLLKPIVEAYKKETGVSVKLVSDKEGPLMERLRAEGRNSPADLLLTVDA 80

Query: 83  TSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L   E   LL  + + ++       L++  ++   +S   + + Y+T+++K + L  S
Sbjct: 81  GNLWQAERMGLLKAVQSPVLDANVPAHLRDPARQWYGLSIRARTIFYNTQKVKPSQL-SS 139

Query: 140 VFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             DL + +WK +L +  +   +   L+  M         +  IK    N     +
Sbjct: 140 YADLADPKWKGKLCLRTSKKVYNQSLVGMMLAETGPAKTEQVIKGWVGNLAAAPF 194


>gi|163761127|ref|ZP_02168204.1| extracellular solute-binding protein, family 1 [Hoeflea
           phototrophica DFL-43]
 gi|162281678|gb|EDQ31972.1| extracellular solute-binding protein, family 1 [Hoeflea
           phototrophica DFL-43]
          Length = 343

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 74/191 (38%), Gaps = 10/191 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +   L  +  F       +    + +Y+ ++      +   F + TG+K++ I     +
Sbjct: 7   RLLALLASVSMFAGTALPAHAEGEVNIYSSRHYDTDERLYSDFTDATGIKVNLIEAKDDE 66

Query: 65  RP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRI 117
                      SP DV IT D   +  A    LL  + + ++ ++    L++ +     +
Sbjct: 67  LIERLKAEGANSPADVFITVDAGRIWRADQAGLLAPVQSEVLAERIPEALRHPDGHWFGV 126

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTV 176
           S   +V+ Y   ++     P++  DL + ++K ++   +  NI    LL +      +  
Sbjct: 127 STRARVIFYDKDKVSE--PPQTYADLADPKYKGQVCARSGTNIYMLSLLASQIAHNGEEA 184

Query: 177 VQDFIKNITAN 187
            + + + +  N
Sbjct: 185 AKAWAQGLKDN 195


>gi|326564138|gb|EGE14376.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis 46P47B1]
          Length = 331

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 81/191 (42%), Gaps = 9/191 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---- 66
           L++     A +       + +Y+ +   ++ PI  +++++TG K++ +   +        
Sbjct: 4   LVMAALVMATAAPAFANEIVVYSARADELLKPIAEAYQQKTGTKVTVVSDKAGPLMERLK 63

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
              + +  DV+IT D  +L  A    +L  + + ++K      L++       +S   + 
Sbjct: 64  AEGKNTQADVLITVDGGNLWQATQAGVLRPINSSVLKSNIPSHLRDPKNHWFGLSVRART 123

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           + Y+  ++  ++L  +  DL + +WK RL +  +N  +   L+ TM     +      +K
Sbjct: 124 IFYNPNKVNPSEL-STYADLADPKWKGRLCLRTSNNVYNQSLVATMIANHGQATANRVVK 182

Query: 183 NITANEILTKY 193
              +N     +
Sbjct: 183 GWVSNLAAAPF 193


>gi|190571080|ref|YP_001975438.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019600|ref|ZP_03335406.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357352|emb|CAQ54783.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995022|gb|EEB55664.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 338

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 82/188 (43%), Gaps = 6/188 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           ++   LL++  F    S  + ++ + +Y+ + + ++  +   F + TG+K+  I     Q
Sbjct: 9   SLVAALLIVVNFLYKNSGIDDSQVVNVYSSRKEELVHSLFDDFTKTTGIKVRYIIDDYSQ 68

Query: 65  RPPITQ-GSPVDVIITKDETSLALNE--DLLHKLPAHLIK-KNSFVLKNENKKLMRISFD 120
                + G   D+ +T D  +L L +   LL ++ +  +K       ++       ++  
Sbjct: 69  LLSRMENGGEADLFLTADAVNLILAKKRGLLSQVDSETLKNAIPAKFRDNEDYWFGLTKR 128

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQD 179
            ++L Y+ + +   +L  +  DL N +WK ++ + +  +     L+  M         ++
Sbjct: 129 ARILVYNKESVDPKEL-STYEDLANEKWKGKILVRSSTSPYNRSLIAFMIAKNGFEKTKE 187

Query: 180 FIKNITAN 187
           ++  I +N
Sbjct: 188 WVSGIVSN 195


>gi|88799343|ref|ZP_01114921.1| ABC-type Fe3+ transport system, periplasmic component [Reinekea sp.
           MED297]
 gi|88777882|gb|EAR09079.1| ABC-type Fe3+ transport system, periplasmic component [Reinekea sp.
           MED297]
          Length = 338

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 93/194 (47%), Gaps = 14/194 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           FK+ +   +L   G T         + +++Y+ + ++++ P++  F E+TG+K++ +  S
Sbjct: 3   FKQWVGALVLTSVGLT-----ATAAEQVSVYSARKEALIKPLLDQFSEQTGIKVNLVTGS 57

Query: 62  --SIQRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKL 114
             ++ +    +G  S  DV +T D   L  A   ++L  + + +++ +    L++ +   
Sbjct: 58  ADTLLKRLELEGQYSKADVFVTVDAGRLYRAKMAEVLQPIESDVLEARVPANLQDADNFW 117

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPN 173
             +S   + + Y+   +   ++ +S   L + QW+ R+ +  + NI    L+ ++ +   
Sbjct: 118 FGLSQRARTVFYNKNTVADGEI-QSYEQLADEQWRGRICVRSSDNIYNQSLVASLIEHNG 176

Query: 174 KTVVQDFIKNITAN 187
               +++ + + AN
Sbjct: 177 IDATENWAEGVVAN 190


>gi|51245248|ref|YP_065132.1| iron(III) ABC transporter, periplasmic binding protein [precursor]
           [Desulfotalea psychrophila LSv54]
 gi|50876285|emb|CAG36125.1| related to iron(III) ABC transporter, periplasmic binding protein
           [Precursor] [Desulfotalea psychrophila LSv54]
          Length = 338

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 81/201 (40%), Gaps = 11/201 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           MF R +   L +        S     + + +Y+ + + ++ P+   + ++TGVK+  +  
Sbjct: 5   MFPRLLALTLAMTISLPIFVSAAG--EEVVVYSARKEHLIKPLFDLYTQKTGVKVKFLTG 62

Query: 61  SSI----QRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKK 113
            +     +     + SP D+ IT D  +L  A    +L  + + ++       L++    
Sbjct: 63  KAGVLLERLKAEGENSPADIYITVDAGNLWQAKEAGVLQPVNSTILATNIPENLRDPENN 122

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTP 172
              +S   + + Y+T+      L  +  DL + +W+ +L +  +   +   L+ ++    
Sbjct: 123 WFGLSVRARTIVYNTETGIADKL-STYEDLADKKWQGKLVLRTSKKVYNQSLVASLIADY 181

Query: 173 NKTVVQDFIKNITANEILTKY 193
                ++ +K   AN     +
Sbjct: 182 GVEKAEEIVKGWVANLATDPF 202


>gi|113476891|ref|YP_722952.1| extracellular solute-binding protein [Trichodesmium erythraeum
           IMS101]
 gi|110167939|gb|ABG52479.1| extracellular solute-binding protein, family 1 [Trichodesmium
           erythraeum IMS101]
          Length = 349

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 80/191 (41%), Gaps = 11/191 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            I T  +   G +     ++    + LY+ ++      +  SF ++TG+K++ I     +
Sbjct: 14  AIATVAIAELGKSNRGLAQSGA--INLYSSRHYDTDQALYDSFTKKTGLKVNLIEGKGDK 71

Query: 65  RP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRI 117
                      SP DV +T D   L  A    +L  + +  +  K    L++  K     
Sbjct: 72  LIERIKSEGANSPADVFMTVDAGRLWRAQEAGILQPISSSTLNNKIPANLRSPEKLWFGF 131

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTV 176
           S   +V+ Y+  +++ ++L  +  DL   +WK ++ I + +NI    L+ ++ +    + 
Sbjct: 132 SKRARVIMYNKNKVQPSEL-STYEDLAQNKWKGKIVIRSSSNIYNQSLIASLIEIHGMSD 190

Query: 177 VQDFIKNITAN 187
            + + K    N
Sbjct: 191 AEGWAKGFVRN 201


>gi|150392310|ref|YP_001322359.1| extracellular solute-binding protein [Alkaliphilus metalliredigens
           QYMF]
 gi|149952172|gb|ABR50700.1| extracellular solute-binding protein, family 1 [Alkaliphilus
           metalliredigens QYMF]
          Length = 359

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 78/193 (40%), Gaps = 10/193 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTT---KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            ++ ++ + C   +  S E        L +Y+ +N+  +  ++  F E TG+++  ++ +
Sbjct: 14  ALFAFITVGCSSEQPASGEQGDSESNELVVYSGRNERFVQALLEKFTEDTGIEVLALHGA 73

Query: 62  S-IQRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRIS 118
           + +Q          D+ I+ D  +L    ++ LL       I+      + E+     IS
Sbjct: 74  NPLQIAEEKNNVRADIFISNDLGALGYLDSKGLLQGSNPEGIETIPADFRAEDNAYFAIS 133

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQW---KKRLSIA-PNNISFHRLLNTMEQTPNK 174
              +   Y+   I   ++PKS  DL +++W   +   +I    N      ++ +      
Sbjct: 134 ARARGFIYNKDMITEEEMPKSNEDLFDSKWATVENGFAITRGGNGGMTGHVSALRYQWGD 193

Query: 175 TVVQDFIKNITAN 187
               ++I  I AN
Sbjct: 194 EKTAEWIAAIRAN 206


>gi|229917657|ref|YP_002886303.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
 gi|229469086|gb|ACQ70858.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
          Length = 353

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 83/196 (42%), Gaps = 12/196 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKY---LTLYTDQNQSVMLPIIHSFEERTGVKISPIY 59
              + T LL  C  T+  ++   +     + +Y+ ++  V   +   FEE TG+K++ + 
Sbjct: 11  SAALTTSLLAACASTDETTSNEGSDDSNVVNVYSSRHYDVDQQLYKQFEEETGIKVNVVE 70

Query: 60  TSSIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENK 112
             S +         + +  D+ IT D  +L  A     L  + +  ++       ++ + 
Sbjct: 71  GKSDELLERLNTEGENTEADLFITADAGNLYQAKEAGHLQAVDSDELESNIPEKYRDTDN 130

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQT 171
           +   ++   +V+ YS  R+K  DL  +   LT  QW  ++ + P+ N+    LL +  + 
Sbjct: 131 EWFGLTKRARVIVYSKDRVKPEDL-STYEALTEEQWNGKVLVRPSENMYNISLLASFIEV 189

Query: 172 PNKTVVQDFIKNITAN 187
                 +++ K +  N
Sbjct: 190 NGVDEAKEWAKGLVNN 205


>gi|269469043|gb|EEZ80604.1| iron ABC transporter substrate-binding protein [uncultured SUP05
           cluster bacterium]
          Length = 339

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 40/200 (20%), Positives = 85/200 (42%), Gaps = 11/200 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PI 58
           +    I   +L +   T   +T  +   +T+Y+ + + ++ P+  +F + TGVK+     
Sbjct: 6   LISSAIVFSVLTVSSITTVQAT--SDDSVTVYSSRKEHLIKPLFEAFTKDTGVKVEYLTG 63

Query: 59  YTSSIQRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKK 113
              ++      +G  +P D+ +T D  +L    ++DL   +    +K      L++ +  
Sbjct: 64  KGGALIERLKLEGANTPADMFMTVDAGNLWYVGSQDLFQPVQTETLKSNIPSHLRDPDGL 123

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTP 172
              +S   + + YST R+  ADL  +  DL+ ++WK +L +  +   +   L  ++    
Sbjct: 124 WTGLSVRARTIVYSTDRVNSADL-STYADLSASKWKGKLCLRTSKKIYTKSLAASVIYNH 182

Query: 173 NKTVVQDFIKNITANEILTK 192
            +    D I     N   T 
Sbjct: 183 GEDKAGDIISGWVNNLAATP 202


>gi|331005996|ref|ZP_08329339.1| Ferric iron ABC transporter, iron-binding protein [gamma
           proteobacterium IMCC1989]
 gi|330420172|gb|EGG94495.1| Ferric iron ABC transporter, iron-binding protein [gamma
           proteobacterium IMCC1989]
          Length = 342

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 85/198 (42%), Gaps = 11/198 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKY--LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
             T L+ +  F+   +     K   +T+Y+ + + ++ P+   +  +TG ++  I   + 
Sbjct: 10  AVTALVSVLSFSPVVAATEAAKDNVITVYSSRKEHLIKPLFDRYTAKTGTQVRFITDKAG 69

Query: 63  ---IQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       +P D+ +T D   L  A  EDL  K+ + +++      L++       
Sbjct: 70  PLMARLKAEGASTPADIFMTVDAGVLWQASEEDLFRKVDSPVLEAAVPANLQSAKDDWYG 129

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           +S   + L YST R+K +DL  +   L N  WK R+ +  +   ++  L+ TM  T  + 
Sbjct: 130 LSIRARTLVYSTDRVKPSDL-STYEALANDDWKGRVCLRTSKKIYNKSLVATMINTLGEE 188

Query: 176 VVQDFIKNITANEILTKY 193
             +  +K   AN     +
Sbjct: 189 KTEAIVKGWVANLAAPPF 206


>gi|68171427|ref|ZP_00544817.1| extracellular solute-binding protein, family 1 [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|67999147|gb|EAM85807.1| extracellular solute-binding protein, family 1 [Ehrlichia
           chaffeensis str. Sapulpa]
          Length = 347

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           I   +L    FT+    ++ T+ + +Y+ + + ++  +   F + TG+ +  I   + Q 
Sbjct: 11  IAVVILAFSFFTKKQQVQDLTQEVRVYSSRKEELLHSLFKQFTKETGINVKYINDEAAQL 70

Query: 66  PPITQG----SPVDVIITKDETS--LALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
               +     +  DV +T D  +  LA  + LL  + + ++ +      ++       ++
Sbjct: 71  INRMENEGTATSADVFLTADAVNLILAKKKGLLQPVQSEVLNQAIPSKYRDSEGFWFGLT 130

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+   ++ +DL  +   L N +WK ++ + + ++     L+  M         
Sbjct: 131 KRARVIVYNKDLVEKSDL-STYEHLANTKWKDKILVRSSSSPYNQSLIAFMIANNGIENT 189

Query: 178 QDFIKNITAN 187
           + ++K + +N
Sbjct: 190 KIWVKGLVSN 199


>gi|326566484|gb|EGE16631.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis 103P14B1]
 gi|326577209|gb|EGE27102.1| Iron (III) ABC transporter iron binding protein FbpA [Moraxella
           catarrhalis 101P30B1]
          Length = 331

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 81/191 (42%), Gaps = 9/191 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP---- 66
           L++     A +       + +Y+ +   ++ PI  +++++TG K++ +   +        
Sbjct: 4   LVMAALVMATAAPAFANEIVVYSARADELLKPIAEAYQQKTGTKVTVVSDKAGPLMERLK 63

Query: 67  PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
              + +  DV+IT D  +L  A    +L  + + ++K      L++       +S   + 
Sbjct: 64  AEGKNTQADVLITVDGGNLWQATQAGVLRPINSSVLKSNIPSHLRDPKNHWFGLSVRART 123

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIK 182
           + Y+  ++  ++L  +  DL + +WK RL +  +N  +   L+ TM     +      +K
Sbjct: 124 IFYNPNKVNSSEL-STYADLADPKWKGRLCLRTSNNVYNQSLVATMIANHGQATANRVVK 182

Query: 183 NITANEILTKY 193
              +N     +
Sbjct: 183 GWVSNLAAAPF 193


>gi|42520728|ref|NP_966643.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99034659|ref|ZP_01314604.1| hypothetical protein Wendoof_01000580 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410468|gb|AAS14577.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 341

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 82/188 (43%), Gaps = 6/188 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           ++   +L++  +       N ++ + +Y+ + + ++  +   F + TG+K+  I     Q
Sbjct: 9   SLIAIILIVITYLYRNDGTNDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQ 68

Query: 65  RPPITQ-GSPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFD 120
                + G   D+ +T D  +L L +   LL ++ + ++K       ++       ++  
Sbjct: 69  LLSRMENGGEADLFLTADAINLILAKKRGLLSQVDSEVLKSVIPARFRDSEDYWFGLTKR 128

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQD 179
            ++L Y+ + +   DL  +  DL N +WK ++ + +  +     L+  M         ++
Sbjct: 129 ARILVYNKESVDPKDL-STYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKTKE 187

Query: 180 FIKNITAN 187
           ++  I +N
Sbjct: 188 WVSGIVSN 195


>gi|113866786|ref|YP_725275.1| ABC transporter periplasmic protein [Ralstonia eutropha H16]
 gi|113525562|emb|CAJ91907.1| ABC-type transporter, periplasmic component: FeTfamily [Ralstonia
           eutropha H16]
          Length = 345

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITK 80
             K L LYT ++      +  +F ++TG+KI+ I                 SP DV IT 
Sbjct: 27  QEKVLNLYTARHYQTDEALYANFTKQTGIKINRIEGQEDPLLERIRNEGANSPADVFITV 86

Query: 81  DETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D   L  A    +   + +  ++ +     ++ N +    S   +V+AY+   +K  D+ 
Sbjct: 87  DIGRLWRAQQAGVFAPVKSKALESRIPANYRDPNGEWFGFSARGRVIAYNKTAVKAGDI- 145

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            S  DL + +WK ++    +   ++  L++++     +   + + + + AN
Sbjct: 146 ASYEDLADPKWKGKVCTRSSGHVYNLSLVSSLIAHDGEARTEQWARGVAAN 196


>gi|88658650|ref|YP_507013.1| putative iron-binding protein [Ehrlichia chaffeensis str. Arkansas]
 gi|88600107|gb|ABD45576.1| putative iron-binding protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 346

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           I   +L    FT+    ++ T+ + +Y+ + + ++  +   F + TG+ +  I   + Q 
Sbjct: 10  IAVVILAFSFFTKKQQVQDLTQEVRVYSSRKEELLHSLFKQFTKETGINVKYINDEAAQL 69

Query: 66  PPITQG----SPVDVIITKDETS--LALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
               +     +  DV +T D  +  LA  + LL  + + ++ +      ++       ++
Sbjct: 70  INRMENEGTATSADVFLTADAVNLILAKKKGLLQPVQSEVLNQAIPSKYRDSEGFWFGLT 129

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+   ++ +DL  +   L N +WK ++ + + ++     L+  M         
Sbjct: 130 KRARVIVYNKDLVEKSDL-STYEHLANTKWKDKILVRSSSSPYNQSLIAFMIANNGIENT 188

Query: 178 QDFIKNITAN 187
           + ++K + +N
Sbjct: 189 KIWVKGLVSN 198


>gi|58697102|ref|ZP_00372545.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698469|ref|ZP_00373376.1| iron compound ABC transporter, periplasmic iron-compound-binding
           protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630580|ref|YP_002727371.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia sp. wRi]
 gi|58535008|gb|EAL59100.1| iron compound ABC transporter, periplasmic iron-compound-binding
           protein, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536611|gb|EAL59938.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592561|gb|ACN95580.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Wolbachia sp. wRi]
          Length = 341

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 82/188 (43%), Gaps = 6/188 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           ++   +L++  +       N ++ + +Y+ + + ++  +   F + TG+K+  I     Q
Sbjct: 9   SLIAIILIVITYLYRNDGTNDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQ 68

Query: 65  RPPITQ-GSPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFD 120
                + G   D+ +T D  +L L +   LL ++ + ++K       ++       ++  
Sbjct: 69  LLSRMENGGEADLFLTADAINLILAKKRGLLSQVDSEVLKSVIPARFRDSEDYWFGLTKR 128

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQD 179
            ++L Y+ + +   DL  +  DL N +WK ++ + +  +     L+  M         ++
Sbjct: 129 ARILVYNKESVDPKDL-STYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKTKE 187

Query: 180 FIKNITAN 187
           ++  I +N
Sbjct: 188 WVSGIVSN 195


>gi|4894577|gb|AAD32554.1|AF117273_2 iron-binding protein precursor [Ehrlichia chaffeensis]
          Length = 347

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           I   +L    FT+    ++ T+ + +Y+ + + ++  +   F + TG+ +  I   + Q 
Sbjct: 11  IAVVILAFSFFTKKQHVQDLTQEVRVYSSRKEELLHSLFKQFTKETGINVKYINDEAAQL 70

Query: 66  PPITQG----SPVDVIITKDETS--LALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
               +     +  DV +T D  +  LA  + LL  + + ++ +      ++       ++
Sbjct: 71  INRMENEGTATSADVFLTADAVNLILAKKKGLLQPVQSEVLNQAIPSKYRDSEGFWFGLT 130

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+   ++ +DL  +   L N +WK ++ + + ++     L+  M         
Sbjct: 131 KRARVIVYNKDLVEKSDL-STYEHLANTKWKDKILVRSSSSPYNQSLIAFMIANNGIENT 189

Query: 178 QDFIKNITAN 187
           + ++K + +N
Sbjct: 190 KIWVKGLVSN 199


>gi|212712681|ref|ZP_03320809.1| hypothetical protein PROVALCAL_03778 [Providencia alcalifaciens DSM
           30120]
 gi|212684597|gb|EEB44125.1| hypothetical protein PROVALCAL_03778 [Providencia alcalifaciens DSM
           30120]
          Length = 386

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 85/193 (44%), Gaps = 21/193 (10%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSS 62
           T+ + L++ C              LTLYT +   ++ P++ +F + T + ++ +Y     
Sbjct: 54  TLASSLIVTCALPAMAKD-----SLTLYTTREPGLIQPLLDAFTKETAIDVNTVYVKDGM 108

Query: 63  IQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRIS 118
           ++R     + SP D+++T D  +L   +   +   + +  +       L++++ +   +S
Sbjct: 109 LERVKAEGKNSPADLLMTVDAGNLIDLVEAGVTQPVESKTLTDAIPASLRDKDNQWFGLS 168

Query: 119 FDTQVLAYSTKRIKIADLP-KSV--FDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNK 174
              +VL          DLP KS+   DL + +WK ++ I A  +     L+  M     +
Sbjct: 169 MRARVL------YAEKDLPLKSITYEDLADPKWKDKICIRAGQHPYNTALVAAMIAHDGE 222

Query: 175 TVVQDFIKNITAN 187
              + +++ + AN
Sbjct: 223 AKTEAWLRGVKAN 235


>gi|73666761|ref|YP_302777.1| extracellular solute-binding protein [Ehrlichia canis str. Jake]
 gi|46403859|gb|AAS92975.1| iron-binding protein FbpA [Ehrlichia canis]
 gi|72393902|gb|AAZ68179.1| extracellular solute-binding protein, family 1 [Ehrlichia canis
           str. Jake]
          Length = 347

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           +   ++     T     ++  + + +Y+ + + ++  +   F + TG+K+  I   + Q 
Sbjct: 11  VAVIIVAFNFLTNKQQVQDQKQEVHVYSSRKEELLHSLFEQFTKETGIKVKYINDEAAQL 70

Query: 66  PPITQG----SPVDVIITKDETS--LALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
               +     +  DV +T D  +  LA  + LL  + + ++ +      ++       ++
Sbjct: 71  INRMENEGTATSADVFLTADAVNLILAKKKGLLQPIQSEVLNQAIPSKYRDSEGFWFGLT 130

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+   ++  +L  +   L N +WK ++ + + ++     L+  M         
Sbjct: 131 KRARVIVYNKDLVEDNEL-STYEHLANTKWKDKILVRSSSSPYNQSLIAFMVANNGVENT 189

Query: 178 QDFIKNITAN 187
           + ++K + AN
Sbjct: 190 KIWVKGLVAN 199


>gi|88607705|ref|YP_504684.1| iron-binding protein [Anaplasma phagocytophilum HZ]
 gi|88598768|gb|ABD44238.1| iron-binding protein [Anaplasma phagocytophilum HZ]
          Length = 336

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 85/188 (45%), Gaps = 11/188 (5%)

Query: 10  LLLLCGFTEAFS--TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP 67
           +L +C    A++  +    K + +Y+ + + ++  +   F   TG+++  I   + Q   
Sbjct: 2   VLAICFGVIAYNKHSSIQEKVVNVYSSRKEELLRDLFKKFTADTGIQVRYINDEAAQLIA 61

Query: 68  ITQG----SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFD 120
             +     S  DV +T D  +L  A  + LL  + + ++++      ++ +     ++  
Sbjct: 62  RMESEGAYSEADVFLTADAVNLILAKKKGLLQPVRSEILEQVIPARYRDNDGYWFGLTKR 121

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQD 179
            +++ Y+   + ++ L  +  DL +++W+ ++ +  +N  +   L+  M         ++
Sbjct: 122 ARIVVYNKDLVDVSQL-STYEDLADSKWRNQILVRSSNSPYNQSLIAFMVANNGMEATRE 180

Query: 180 FIKNITAN 187
           +++ + +N
Sbjct: 181 WVRGLVSN 188


>gi|126728802|ref|ZP_01744617.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Sagittula stellata E-37]
 gi|126710732|gb|EBA09783.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Sagittula stellata E-37]
          Length = 334

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 79/177 (44%), Gaps = 8/177 (4%)

Query: 18  EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI---YTSSIQRPPITQGSPV 74
            A +T    + + +Y+ +   ++ P+  +F E TG+K++          +     + SP 
Sbjct: 12  LAMATPVMAQEVNVYSYRQPELLAPLTEAFTEETGIKVNVAFLEQGMVERLQAEGRRSPA 71

Query: 75  DVIITKDETSLAL--NEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV++T D + L       +   + +  + K    +  + +K+   ++   +V+  S +R+
Sbjct: 72  DVVLTVDISRLNAVVAAGVTQPVESDTLMKNVPAIYHDPDKQWWGLTTRARVVYASKERV 131

Query: 132 KIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              ++  +  DL + +WK R+   +  +     L++ M     +   +++++ + AN
Sbjct: 132 AEGEV-TTYEDLADPKWKGRICTRSGTHAYNVALVSAMLVHHGEEYTREWLEGVKAN 187


>gi|134299387|ref|YP_001112883.1| extracellular solute-binding protein [Desulfotomaculum reducens
           MI-1]
 gi|134052087|gb|ABO50058.1| extracellular solute-binding protein, family 1 [Desulfotomaculum
           reducens MI-1]
          Length = 355

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 92/197 (46%), Gaps = 16/197 (8%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKY-------LTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           + T +L+L G + + +   + +        + LYTD++      +   F + TG+K++ +
Sbjct: 12  VITAMLVLSGCSASNNNTASKETDNKENGVINLYTDRHYDTDQALFDLFTKETGIKVNVV 71

Query: 59  YTSSIQR----PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNEN 111
              S +         + +  D++IT D   L  A  ++LL    +  + K     L++++
Sbjct: 72  KAESDELIERLAREGKDTKADLLITADAGRLYRAKEKELLQTTSSETLFKNVPENLRDKD 131

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQ 170
            +   ++   +V+ Y+  R+  A L  +  DLT+A+WK ++ + + NNI    LL +   
Sbjct: 132 NQWFGLTKRARVIVYAKDRVDPAQL-STYEDLTDAKWKGKVLVRSANNIYNQSLLASFIA 190

Query: 171 TPNKTVVQDFIKNITAN 187
              +   + + K++ AN
Sbjct: 191 LNGEDQAKAWAKDLVAN 207


>gi|159027971|emb|CAO87134.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 351

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 80/194 (41%), Gaps = 9/194 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
                 T  L +    +       TK L LY+ ++ +    +  +F  +TG+KI+ +   
Sbjct: 11  LGAGTATLALAVGQLGKINEVSAQTKQLNLYSSRHYNTDRRLYDNFTRQTGIKINLVEGE 70

Query: 62  SIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKL 114
           +           + SP D+++T D   L  A  + +   + + ++ ++    L++     
Sbjct: 71  ADPLIERIKSEGRNSPADILLTVDAGRLWRADQQGIFAPVNSPILIQRIPAHLRHPKGHW 130

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPN 173
              S   +V+ Y+  R+   ++  S  DLTN +WK + ++ + +NI        +     
Sbjct: 131 FGFSKRLRVIMYNKDRVNPREI-DSYADLTNPKWKGKVVTRSSSNIYSQSFTAWLIDIQG 189

Query: 174 KTVVQDFIKNITAN 187
           +   + + + + AN
Sbjct: 190 EAAAEKWCRGLVAN 203


>gi|289207484|ref|YP_003459550.1| extracellular solute-binding protein family 1 [Thioalkalivibrio sp.
           K90mix]
 gi|288943115|gb|ADC70814.1| extracellular solute-binding protein family 1 [Thioalkalivibrio sp.
           K90mix]
          Length = 345

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 69/163 (42%), Gaps = 9/163 (5%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQ 70
                  +      + LY+ + ++++ P++  F E TG+K++ +  S+           +
Sbjct: 19  SMPLVGCSPADEDEVNLYSARQENLIQPLLEQFTEETGIKVNLVTGSADSLLQRLRHEGR 78

Query: 71  GSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYS 127
            SP DV+IT D   L  A    +L  + +  + +      ++   +   +S   + + Y 
Sbjct: 79  NSPADVLITVDAGRLHHAQQAGVLQAVESDTLNENIPERYRDPEGEWYGLSLRARPILYH 138

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTME 169
             R+   DL  +   LT+ QW+ R+ I  + N+    L+  M 
Sbjct: 139 KDRVDPDDL-STYEALTDEQWEGRICIRSSDNVYNQSLVAAMI 180


>gi|256823674|ref|YP_003147637.1| family 1 extracellular solute-binding protein [Kangiella koreensis
           DSM 16069]
 gi|256797213|gb|ACV27869.1| extracellular solute-binding protein family 1 [Kangiella koreensis
           DSM 16069]
          Length = 359

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 38/184 (20%), Positives = 78/184 (42%), Gaps = 9/184 (4%)

Query: 18  EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSP 73
            A  + +  K + +YT + + ++ P    F   TG++I+ I  S            + +P
Sbjct: 39  AATQSNDNNKEIVVYTSRKEHLVKPFFEQFTAETGIEINYITDSEAALISRLKAEGERTP 98

Query: 74  VDVIITKDETS--LALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKR 130
            DV+IT D  +  LA  ED+L  + +  ++      L++       ++   + + YST+R
Sbjct: 99  ADVLITVDAGNLWLATQEDVLQPIESQALEAAIPDSLQDPENHWFGLTVRARTVVYSTER 158

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEI 189
           +K  +L  +   L   QW  RL +  +   +   L+  +     +   Q  +++  AN  
Sbjct: 159 VKPEEL-TTYEALGEEQWNGRLCLRTSKKVYNQSLVAMLIARYGEEKTQQIVESWVANLA 217

Query: 190 LTKY 193
              +
Sbjct: 218 TDPF 221


>gi|288958084|ref|YP_003448425.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
 gi|288910392|dbj|BAI71881.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
          Length = 340

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 84/196 (42%), Gaps = 13/196 (6%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           MF   I   +  +C  +     +   + + +Y  ++ +    I  +F + TG+K++ +  
Sbjct: 1   MFTDKIAAVVFAVCALSAF---DVQAQEVNVYNSRHYNTDRTIYETFTKATGIKVNIVEG 57

Query: 61  SSIQRP----PITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIK--KNSFVLKNENK 112
           +  +           SP D++IT D   LA      LL  + +  ++  K    L++ + 
Sbjct: 58  NHDELIQRLKSEGASSPADLLITVDAGRLAAAAKDGLLAPVSSPALEAVKVPANLRDPDG 117

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQT 171
               +S   +++ Y+  R+K   + K   DL   +WK R+ + +  +     L  +M + 
Sbjct: 118 AWWGLSSRARIIVYARDRVKPERI-KDYEDLAKPEWKHRVLTRSGTHSYSLALTASMVEA 176

Query: 172 PNKTVVQDFIKNITAN 187
             +   ++++K + AN
Sbjct: 177 LGEEKTEEWVKGLVAN 192


>gi|46403861|gb|AAS92976.1| iron-binding protein FbpA [Ehrlichia muris]
          Length = 347

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
           I   +L    FT+    +N+ + + +Y+ + + ++  +   F + TG+ +  I   + Q 
Sbjct: 11  IAVIMLAFNFFTKRQQVQNSGQEVRVYSSRKEELLHSLFEQFTKETGINVQYINDEAAQL 70

Query: 66  PPITQG----SPVDVIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
               +     +  DV +T D  +L L +   LL  + + ++ +      ++ +     ++
Sbjct: 71  INRMENEGTATSADVFLTADAVNLILAKKNGLLQPVQSEVLNQAIPSKYRDSDGFWFGLT 130

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+   I+ ++L  +   L N +WK ++ I + ++     L+  M         
Sbjct: 131 KRARVIVYNKDVIEESEL-STYEYLANTKWKDKILIRSSSSPYNQSLIAFMIANNGIENT 189

Query: 178 QDFIKNITAN 187
           + +IK + +N
Sbjct: 190 KIWIKGLVSN 199


>gi|225677346|ref|ZP_03788319.1| iron compound ABC transporter, periplasmic iron [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590614|gb|EEH11868.1| iron compound ABC transporter, periplasmic iron [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 341

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 82/188 (43%), Gaps = 6/188 (3%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           ++   +L++  +       N ++ + +Y+ + + ++  +   F + TG+K+  I     Q
Sbjct: 9   SLIAIILIVITYLYRNDGTNDSQVVNVYSSRKEELVRTLFDEFTKNTGIKVRYIIDDYSQ 68

Query: 65  RPPITQ-GSPVDVIITKDETSLALNE--DLLHKLPAHLIKKN-SFVLKNENKKLMRISFD 120
                + G   D+ +T D  +L L +   LL ++ + ++K       ++       ++  
Sbjct: 69  LLSRMENGGEADLFLTADAINLILAKKRGLLSQVDSGVLKSVIPARFRDSEDYWFGLTKR 128

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQD 179
            ++L Y+ + +   DL  +  DL N +WK ++ + +  +     L+  M         ++
Sbjct: 129 ARILVYNKESVDPKDL-STYEDLANEKWKGKILVRSSTSPYNRSLIAFMIANNGFEKTKE 187

Query: 180 FIKNITAN 187
           ++  I +N
Sbjct: 188 WVSGIVSN 195


>gi|118602697|ref|YP_903912.1| extracellular solute-binding protein [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567636|gb|ABL02441.1| extracellular solute-binding protein, family 1 [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 339

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 81/196 (41%), Gaps = 9/196 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           ++   +L L     + +   +   +T+Y+ + + ++ P+  SF + TG+K++ +      
Sbjct: 8   SLTLIMLALTITNASLAQTKSEDLITVYSSRKEHLIKPLFESFTKDTGIKVTYLTGKGSA 67

Query: 65  RP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
                    + +  D+ +T D  +L  A  +DL   +    +K      L++       +
Sbjct: 68  LIERLKLEGKNTKADMFMTVDAGNLWYAATQDLFQAVQTQTLKSNIPSHLRDPKGLWTGL 127

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTV 176
           S   + + YST+R+   DL  +  +L + +W  RL +  +   +   L+ +M     K  
Sbjct: 128 SVRARTIVYSTERVNPTDL-STYENLADTKWSGRLCLRSSKKIYTKSLVASMIYHQGKNK 186

Query: 177 VQDFIKNITANEILTK 192
           V D I     N   T 
Sbjct: 187 VGDIISGWVNNLAATP 202


>gi|83945632|ref|ZP_00957978.1| iron transport system substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
 gi|83850998|gb|EAP88857.1| iron transport system substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
          Length = 350

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 80/195 (41%), Gaps = 12/195 (6%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKY--LTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
           +++   L+     +    + +++    + +YT ++ +    +  +F E TG++++ I   
Sbjct: 8   KSLLVGLVSFSALSACNPSGSSSGEGVVNVYTARHYASDDALYEAFTEHTGIEVNVIEAP 67

Query: 61  SSIQRPPI---TQGSPVDVIITKDETSL--ALNEDLLHKLPA--HLIKKNSFVLKNENKK 113
             +    +      S  DV+IT D   L  A    L    P    ++      L+  +  
Sbjct: 68  GDLLIERVRADGDRSQADVVITVDAGRLWRADEAGLFQPAPELEGVLANVPANLRQPDGD 127

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTP 172
               S   +V+AY+  R+  +++  S  DLT+ QW+ R+ +  +N  +   LL  M    
Sbjct: 128 WFGFSKRVRVIAYAKDRVDPSEI-SSFEDLTDPQWRGRICVRSSNNVYNQSLLAAMVAQD 186

Query: 173 NKTVVQDFIKNITAN 187
                + + + I  N
Sbjct: 187 GAEAAEAWARGIVEN 201


>gi|94265412|ref|ZP_01289164.1| extracellular solute-binding protein, family 1 [delta
           proteobacterium MLMS-1]
 gi|93454069|gb|EAT04404.1| extracellular solute-binding protein, family 1 [delta
           proteobacterium MLMS-1]
          Length = 339

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 80/192 (41%), Gaps = 9/192 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           R  +  +LLL               + +Y+ + ++++ P++  F E TG+K++ +     
Sbjct: 2   RKCFFPVLLLAVVALWQPAPAAADEVNIYSARQEALIKPVLDRFTEETGIKVNIVAGRPE 61

Query: 64  Q----RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMR 116
                     + SP D+++T D  +L  A+   +   + + ++ +     L++       
Sbjct: 62  ALLQRLQSEGRNSPADLLLTVDAGNLSRAMEAGIFQPVDSRVLAEAVPSHLRDPEGHWFG 121

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKT 175
           +    +V+ Y+ +R +   +  S  DL + +   ++ I  + NI    L+ +        
Sbjct: 122 LGMRARVILYAKERFEPTAI-NSYDDLADPELGPQICIRSSNNIYNQSLVASKIARQGVE 180

Query: 176 VVQDFIKNITAN 187
             +++++ +  N
Sbjct: 181 ATEEWVRGLLNN 192


>gi|307152612|ref|YP_003887996.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
 gi|306982840|gb|ADN14721.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
          Length = 347

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVII 78
              T+ + LY+ ++ +    +  +F ++TG+K++ I   +           + SP D++I
Sbjct: 31  SAQTREVNLYSSRHYNTDRRLYDNFTKQTGIKVNLIEAEADPLIERIKSEGRNSPADILI 90

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D   L  A    L   + + ++++     L+         S   +V+ Y+  R+K + 
Sbjct: 91  TVDAARLWRAYQAGLFTPVNSKILQQKIPANLREPKGHWFAFSERLRVIMYNKNRVKPSQ 150

Query: 136 LPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  S  DL N +WK + +S + ++      +  +  T  +   + + +   AN
Sbjct: 151 L-SSYDDLANPKWKGKVVSRSSSSTYNQSFVAWLIATRGEAAAEKWCRGFVAN 202


>gi|166368409|ref|YP_001660682.1| iron transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166090782|dbj|BAG05490.1| iron transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 351

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 79/199 (39%), Gaps = 9/199 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
                 T  L +    +       TK L LY+ ++ +    +  +F  +TG+KI+ +   
Sbjct: 11  LGAGTATLALAVGQLGKINEVSAQTKQLNLYSSRHYNTDRRLYDNFTRQTGIKINLVEGE 70

Query: 62  SIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKL 114
           +             SP D+++T D   L  A  + +   + + ++ +     L++     
Sbjct: 71  ADPLIERIKSEGSNSPADILLTVDAGRLWRADQQGIFAPVNSRILTQRIPANLRHPKGHW 130

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPN 173
              S   +V+ Y+  R+   ++  S  DLTN +WK + ++ + +NI        +     
Sbjct: 131 FGFSKRLRVIMYNKDRVNPREI-DSYADLTNPKWKGKVVTRSSSNIYSQSFTAWLIDIQG 189

Query: 174 KTVVQDFIKNITANEILTK 192
           +   + + + + AN   + 
Sbjct: 190 EAAAEKWCRGLVANFARSP 208


>gi|194288881|ref|YP_002004788.1| iron(iii)-binding periplasmic protein precursor [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222716|emb|CAQ68719.1| Iron(III)-binding periplasmic protein precursor [Cupriavidus
           taiwanensis LMG 19424]
          Length = 345

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITK 80
             K L LYT ++      +  +F ++TG+KI+ I                 SP DV IT 
Sbjct: 27  QEKVLNLYTARHYQTDEALYANFTKQTGIKINRIEGQEDPLLERIRNEGANSPADVFITV 86

Query: 81  DETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D   L  A    +   + + +++ +     ++ N +    S   +V+AY+   +K  D+ 
Sbjct: 87  DIGRLWRAQQAGVFAPVKSKVLESRIPANYRDPNGEWFGFSARGRVIAYNKAAVKAGDV- 145

Query: 138 KSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
            +  DL + +WK ++    +   ++  L++++     +   + + + + AN
Sbjct: 146 ANYEDLADPKWKGKVCTRSSGHVYNLSLVSSLIAHDGEARTEQWARGVAAN 196


>gi|115526068|ref|YP_782979.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520015|gb|ABJ07999.1| extracellular solute-binding protein, family 1 [Rhodopseudomonas
           palustris BisA53]
          Length = 340

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 79/178 (44%), Gaps = 9/178 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SP 73
                     + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP
Sbjct: 17  PLQVGVAQAAEQVNVYTYRETKLVQPLFDAFTKDTGITVNVISASSGLEQRIKAEGANSP 76

Query: 74  VDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKR 130
            DV++T D   +  A+   +   + + +I +      ++ N     IS   +V+  S +R
Sbjct: 77  ADVLLTVDIGRIDDAVAAGVTQPIGSAVIDEIVPPQYRDPNGHWAGISMRARVIYASKER 136

Query: 131 IKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +K   +  S  +L + +WK R+ I    +I  + L         +   + +++ + AN
Sbjct: 137 VKQDAI--SYEELADPKWKGRICIRSGQHIYNNALFAAYVAKYGEDKAEAWLRGLKAN 192


>gi|114766140|ref|ZP_01445144.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Pelagibaca bermudensis HTCC2601]
 gi|114541600|gb|EAU44642.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Roseovarius sp. HTCC2601]
          Length = 333

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 73/169 (43%), Gaps = 8/169 (4%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY---TSSIQRPPITQGSPVDVIITKDE 82
            + + LY+ +   ++ P+  +F E TG+ ++  +       +       SP D++ T D 
Sbjct: 19  AEEVNLYSYRQPELLAPLTDAFTEATGIDVNVAFLDKGMVERLQAEGDRSPADLVFTVDI 78

Query: 83  TSLAL--NEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + L+   N  L   + + ++ +      ++       ++   +++  S  R+  +++  S
Sbjct: 79  SRLSAVVNAGLTQPVESDVLNENVPEQYRDPEGHWFGLTTRARIVYASKDRVDPSEV-TS 137

Query: 140 VFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + +W+ R+   +  +     L++ M     +   + +++ + +N
Sbjct: 138 YEDLADPKWEGRICTRSGTHPYNVALVSAMLHHHGEEETKTWLEGVKSN 186


>gi|188587480|ref|YP_001919025.1| extracellular solute-binding protein family 1 [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179352167|gb|ACB86437.1| extracellular solute-binding protein family 1 [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 360

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 72/186 (38%), Gaps = 12/186 (6%)

Query: 8   TYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP 67
            ++L  CG     S       L +Y+ +N+  +  ++  F E TG+++  ++ +  Q+  
Sbjct: 24  VFMLTGCG-----SGGEQADELVVYSARNERFVNELLDKFTEDTGIEVKALHGADPQQIE 78

Query: 68  ITQGS-PVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVL 124
               +   D+ I+ D  +L     + LL       I+      + EN     IS  ++  
Sbjct: 79  EEANNVQADIFISNDLGALGYLDEQGLLQGSEPEGIESIPENFRAENNAFFAISLRSRGF 138

Query: 125 AYSTKRIKIADLPKSVFDLTNAQW---KKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDF 180
            Y+   I   D+P S  DL +++W   +   +I    N      ++ +          ++
Sbjct: 139 IYNKDMISEEDMPSSGEDLFDSKWADVEGGYAITRGGNGGMIGHVSALRHEWGDDKTSEW 198

Query: 181 IKNITA 186
           I  I  
Sbjct: 199 IAAIRE 204


>gi|257455483|ref|ZP_05620716.1| ABC transporter, iron binding protein [Enhydrobacter aerosaccus
           SK60]
 gi|257447108|gb|EEV22118.1| ABC transporter, iron binding protein [Enhydrobacter aerosaccus
           SK60]
          Length = 329

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 91/198 (45%), Gaps = 14/198 (7%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           + + T+ +L+   T A +++     L +Y+ +  +++ PI+  +E++TGVKI  +   + 
Sbjct: 2   KRLMTFGMLMGAVTPALASD-----LVIYSARADNLLKPIVAKYEQQTGVKIKLVNDKAG 56

Query: 64  ----QRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       +P D++IT D  +L  A  E++L  + + +++       ++   +   
Sbjct: 57  VLIEKIKAEGANTPADLLITVDGGNLWQAAQENILRPVNSKVLETNIPPQFQDPQNRWFG 116

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKT 175
           +S   + + Y+  +I  + L  +  DL+  +WK +L +  + N+    L+ TM       
Sbjct: 117 MSVRARTIFYNPTKINPSQL-STYADLSTPKWKGKLCLRTSDNVYNQSLVATMIHHNGLP 175

Query: 176 VVQDFIKNITANEILTKY 193
             +  +K   +N     +
Sbjct: 176 QTERILKGWVSNLATAPF 193


>gi|163796271|ref|ZP_02190232.1| extracellular solute-binding protein, family 1 [alpha
           proteobacterium BAL199]
 gi|159178413|gb|EDP62955.1| extracellular solute-binding protein, family 1 [alpha
           proteobacterium BAL199]
          Length = 344

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 82/190 (43%), Gaps = 8/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI- 63
            ++   + +          +  + + +Y+ +   ++ P++ +F E+TG+K + ++     
Sbjct: 8   AMFGTAMAVATLVTGTGVASAAEEVNVYSLRQPFLIEPLLKAFAEQTGIKTNVVFAKEGV 67

Query: 64  --QRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
             +       SP DVI+T D   L  A+   ++  + +  ++       ++   +   ++
Sbjct: 68  VERMKAEGANSPADVILTVDIGRLNDAVEAGVIQPVKSATLEANIPANFRDPEGRWFALT 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVV 177
              +++  S  R+K+ ++  S  +L + +WK R+        ++  LL  M     +   
Sbjct: 128 QRARLIYASKDRVKLGEI-TSYEELADPKWKGRICTRSGKHDYNVALLAAMIAHHGEAKA 186

Query: 178 QDFIKNITAN 187
           ++++  + AN
Sbjct: 187 EEWLNGVKAN 196


>gi|192292992|ref|YP_001993597.1| extracellular solute-binding protein family 1 [Rhodopseudomonas
           palustris TIE-1]
 gi|192286741|gb|ACF03122.1| extracellular solute-binding protein family 1 [Rhodopseudomonas
           palustris TIE-1]
          Length = 336

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 80/173 (46%), Gaps = 9/173 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SPVDVII 78
                + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP DV++
Sbjct: 19  AAGAAEQVNVYTYRETKLVQPLFDAFTKDTGIAVNVISASSGLEQRIKAEGADSPADVLL 78

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D   +  A+   +   + + +I +      ++ N +   IS   +V+  S  R+K   
Sbjct: 79  TVDIGRIDDAVAAGISQPINSAVIDEIVPAQFRDPNGQWAGISMRARVIYASKDRVKQEA 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +  +L + +WK ++ I    +I  + L         +   +++++ + AN
Sbjct: 139 I--TYEELADPKWKGKICIRSGQHIYNNALFAAYVAKHGEAKAEEWLRGLKAN 189


>gi|86748588|ref|YP_485084.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           HaA2]
 gi|86571616|gb|ABD06173.1| extracellular solute-binding protein, family 1 [Rhodopseudomonas
           palustris HaA2]
          Length = 338

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 78/170 (45%), Gaps = 9/170 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SPVDVIITKD 81
             + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP DV++T D
Sbjct: 23  AAEQVNVYTYRETKLVQPLFDAFTKDTGIAVNVISASSGLEQRMKAEGANSPADVLLTVD 82

Query: 82  ETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
              +  A+   +   + + ++ +      ++ +     IS   +V+  S  R+K   +  
Sbjct: 83  IGRIDEAVAAGVTQPIQSAVVDEIVPPRYRDPDGHWAGISMRARVIYASKDRVKQDAI-- 140

Query: 139 SVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +L + +WK ++ I    +I  + L         +   + +++ + AN
Sbjct: 141 TYEELADPKWKGKICIRSGQHIYNNALFAAYIAKHGEEKAEAWLRGLKAN 190


>gi|90425422|ref|YP_533792.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107436|gb|ABD89473.1| extracellular solute-binding protein, family 1 [Rhodopseudomonas
           palustris BisB18]
          Length = 338

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI---TQGSPVDVI 77
            T    + + +YT +   ++ P+  +F + TG+ ++ I  SS     I     GSP DV+
Sbjct: 19  QTAAAAEQVNVYTYRESKLVQPLFDAFTKDTGIAVNVISASSGLEQRIKAEGAGSPADVL 78

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           +T D   +  A+   +   + + +I +      ++ +     IS   +V+  S  R+K  
Sbjct: 79  LTVDIGRIDDAVAAGVSQPINSPVIDEIVPPQYRDPDGHWAGISMRARVIYASKDRVKQQ 138

Query: 135 DLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +  +  +L + +WK ++ I    +I  + L         +   + +++ + AN
Sbjct: 139 AI--TYEELADPKWKGKICIRSGQHIYNNALFAAYAAHHGEAKAEQWLRGLKAN 190


>gi|307546591|ref|YP_003899070.1| ABC transporter periplasmic protein [Halomonas elongata DSM 2581]
 gi|307218615|emb|CBV43885.1| ABC-type transport system periplasmic substrate-binding protein
           [Halomonas elongata DSM 2581]
          Length = 342

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 69/169 (40%), Gaps = 9/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----PPITQGSPVDVIITKDE 82
             L +Y+ ++      +  +F   TG++++ +   S Q           SP DV++T D 
Sbjct: 27  DELNIYSARHYDSDQALYDAFTAETGIEVNVLEGDSDQLIQRIQREGAASPADVMMTVDA 86

Query: 83  TSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             L  A  E +   + +  + ++    +++   K    S   + + Y+  +I   ++  +
Sbjct: 87  GRLWRAEQEGIFASVESATLAERLPDAMRHPEGKWFGFSQRVRAIFYNPDKIDADEI-AT 145

Query: 140 VFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + ++K  + I  + NI    LL ++         + + + +  N
Sbjct: 146 YEDLADPRFKGEICIRSSNNIYNQSLLASLIAHDGAEQAEAWAQGVVDN 194


>gi|149201951|ref|ZP_01878925.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. TM1035]
 gi|149144999|gb|EDM33028.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. TM1035]
          Length = 338

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 81/169 (47%), Gaps = 10/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDE 82
           + + LY+ ++      +  +F + TG+KI+ I     +           SP DV +T D 
Sbjct: 23  QEVNLYSSRHYDSDDALYEAFTKETGIKINRIEGKEAELIERMKAEGANSPADVFMTVDV 82

Query: 83  TSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            ++  A++E LL    + LI+   +  L++ +     +S  ++++ Y+  R+     P++
Sbjct: 83  GNVSRAVDEGLLQPFSSDLIESNVAANLRHPDNLWTGLSQRSRIIFYAKDRV--ETPPQT 140

Query: 140 VFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L + +++ ++ I + +N+    LL ++ +   +   +++   I AN
Sbjct: 141 YEELADPKYQGQICIRSSSNVYNQSLLASIIEVHGEEAAKEWAAGIVAN 189


>gi|133711191|gb|ABO36300.1| IdiA [Trichodesmium tenue Z-1]
          Length = 173

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 74/165 (44%), Gaps = 9/165 (5%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDETSL- 85
           LY+ ++      +  SF ++TG+K++ I     +           SP DV +T D   L 
Sbjct: 2   LYSSRHYDTDQALYDSFTKKTGLKVNLIEGKGDKLIERIRSEGANSPADVFMTVDAGRLW 61

Query: 86  -ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDL 143
            A    +L  + +  +K K    L++        S   +V+ Y+  R++ +DL  +  DL
Sbjct: 62  RAQEAGILQPVSSSTLKTKIPASLRSPENLWFGFSKRARVIMYNKDRVQSSDL-STYEDL 120

Query: 144 TNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              +WK ++ I + +NI    L+ ++ +    +  + + K+  +N
Sbjct: 121 ATDKWKGKILIRSSSNIYNQSLIASLIEIHGMSDAESWAKDFVSN 165


>gi|220908880|ref|YP_002484191.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           7425]
 gi|219865491|gb|ACL45830.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7425]
          Length = 353

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 81/177 (45%), Gaps = 9/177 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPV 74
             + +  ++ L LY+ ++      I  SF ++TG+K++ +   + +           SP 
Sbjct: 28  PSTAQTRSQVLNLYSARHYDTDTAIYASFTQKTGIKVNLVEADADKLIERIKSEGANSPA 87

Query: 75  DVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           DV+IT D   L  A    +L  + + ++ +     L++        S   +V+ Y+  R+
Sbjct: 88  DVLITVDAGRLWRAQQAGILQPVSSRVLNQAIPAELRDPKGFWFGFSRRARVIMYNKDRV 147

Query: 132 KIADLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           K ++L  +  DL N++W+ R +S   +++    L  ++      +  + +++ + AN
Sbjct: 148 KPSEL-STYEDLANSKWRGRLISRTSSHVYNQSLTGSVLAADGASRTEQWVRGLVAN 203


>gi|163845921|ref|YP_001633965.1| extracellular solute-binding protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523643|ref|YP_002568113.1| extracellular solute-binding protein family 1 protein [Chloroflexus
           sp. Y-400-fl]
 gi|163667210|gb|ABY33576.1| extracellular solute-binding protein family 1 [Chloroflexus
           aurantiacus J-10-fl]
 gi|222447522|gb|ACM51788.1| extracellular solute-binding protein family 1 [Chloroflexus sp.
           Y-400-fl]
          Length = 376

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 71/167 (42%), Gaps = 9/167 (5%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--PPITQG--SPVDVIITKDETS-- 84
           +Y+ ++   M      F + TG+++   + S  +       +G  +P DV+ T D  +  
Sbjct: 72  VYSARHYGQMETAFAEFTKETGIEVRFTFGSDAELRERLKAEGRFTPADVLFTVDAANLW 131

Query: 85  LALNEDLLHKLPAHLIKKNSFVL-KNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDL 143
           LA  E LL  + + +++ N     ++ + +   +S   + +AY   R+   ++  +   L
Sbjct: 132 LAAQEGLLRPINSDVLESNIPDYLQDPSNQWYALSLRVRTIAYHPDRVNPEEI-ATYESL 190

Query: 144 TNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEI 189
            + +W  R+   P+  S+   L++++         ++ +     N  
Sbjct: 191 ADPKWAGRICWRPSTKSYTQSLVSSLIVHHGYDKAKEIVTGWAQNAK 237


>gi|91975918|ref|YP_568577.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           BisB5]
 gi|91682374|gb|ABE38676.1| extracellular solute-binding protein, family 1 [Rhodopseudomonas
           palustris BisB5]
          Length = 337

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 78/173 (45%), Gaps = 9/173 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SPVDVII 78
                + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP DV++
Sbjct: 19  QAGAAEQVNVYTYRETKLVQPLFDAFTKDTGIAVNVISASSGLEQRIKAEGANSPADVLL 78

Query: 79  TKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D   +  A+   +   + + +I        ++ +     IS   +V+  S +R+K   
Sbjct: 79  TVDIGRIDEAVQAGITQPIKSAVIDETVPPRYRDPDGHWAGISMRARVIYASKERVKQNA 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +  +L + +WK ++ I    +I  + L         +   + +++ + AN
Sbjct: 139 I--TYEELADPKWKGKICIRSGQHIYNNALFAAYVAKYGEEKAEAWLRGLKAN 189


>gi|260428486|ref|ZP_05782465.1| extracellular solute-binding protein, family 1 [Citreicella sp.
           SE45]
 gi|260422978|gb|EEX16229.1| extracellular solute-binding protein, family 1 [Citreicella sp.
           SE45]
          Length = 333

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 77/190 (40%), Gaps = 12/190 (6%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY---TS 61
            + T  L L     A +     + + LY+ +   ++ P+  +F   TG+ ++  Y     
Sbjct: 2   RLATTALALI----ATAVPALAEEVNLYSYRQPELLAPLTEAFTAETGIDVNVAYLEQGM 57

Query: 62  SIQRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
             +       SP D++ T D + LA   N  +   + + ++        ++       ++
Sbjct: 58  VERLQAEGDRSPADLVFTVDISRLAAVVNAGVTQSVTSEVLNTNVPEQYRDPEGHWFGLT 117

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +++  S  R+  +++  +  DL + +WK R+   +  +     L++ M     +   
Sbjct: 118 TRARIVYASKDRVDPSEV-TTYEDLADPKWKGRICTRSGTHPYNVALVSAMLHHHGEEET 176

Query: 178 QDFIKNITAN 187
           + +++ + +N
Sbjct: 177 KAWLEAVKSN 186


>gi|316935658|ref|YP_004110640.1| family 1 extracellular solute-binding protein [Rhodopseudomonas
           palustris DX-1]
 gi|315603372|gb|ADU45907.1| extracellular solute-binding protein family 1 [Rhodopseudomonas
           palustris DX-1]
          Length = 336

 Score =  151 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 79/173 (45%), Gaps = 9/173 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SPVDVII 78
                + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP DV++
Sbjct: 19  AAGAAEQVNVYTYRETKLVQPLFDAFTKDTGIAVNVISASSGLEQRIKAEGAESPADVLL 78

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D   +  A+   +   + + +I +      ++ N     IS   +V+  S  R+K   
Sbjct: 79  TVDIGRIDDAVAAGISQPINSAVIDEIVPAQFRDPNGHWAGISMRARVIYASKDRVKQET 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +  +L + +WK ++ I    +I  + L         +   +++++ + AN
Sbjct: 139 I--TYEELADPKWKGKICIRSGQHIYNNALFAAYVAKHGEAKAEEWLRGLKAN 189


>gi|332708142|ref|ZP_08428136.1| ABC-type Fe3+ transport system, periplasmic component [Lyngbya
           majuscula 3L]
 gi|332353173|gb|EGJ32719.1| ABC-type Fe3+ transport system, periplasmic component [Lyngbya
           majuscula 3L]
          Length = 350

 Score =  151 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVI 77
                + + +Y+ ++      +  +F   TG+K++ I   +             SP DV+
Sbjct: 18  AVAQNRVVNVYSSRHYKTDDDLYDNFTRITGIKVNLIEGKANPLIERIKSEGANSPADVL 77

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           IT D   L  A    +   + +  +       L++ +      +   +V+ Y+  R+  A
Sbjct: 78  ITVDAGRLWKADQAGIFAPVNSSELNSNIPANLRHPDNHWFGFTKRARVIMYNKDRVNPA 137

Query: 135 DLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +L  +  +L + +W+ R++I + +NI    L+ ++  +     V+ ++++   N
Sbjct: 138 EL-STYENLADPKWQGRIAIRSSSNIYNQSLVASLIASLGVPAVKAWVESFVGN 190


>gi|297570164|ref|YP_003691508.1| extracellular solute-binding protein family 1 [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296926079|gb|ADH86889.1| extracellular solute-binding protein family 1 [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 343

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ- 64
           +   LLL+     A +       + +Y+ + ++++ P++  F E++G+K++ +       
Sbjct: 8   LVPMLLLVFTVAGAPAPVAAAGEVNIYSARQEALIKPLLDRFTEQSGIKVNLVAGRPEAL 67

Query: 65  ---RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFV-LKNENKKLMRIS 118
                   + SP D+++T D  +L  A+   +   + + ++ +   V L++       +S
Sbjct: 68  LQRLQSEGRNSPADLLLTVDAGNLNQAMVAGVFQPVESAVLNEVIPVNLRDPEGHWFGLS 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVV 177
              +V+ Y+  R   A +  S  DL +     ++ I  + N+    L+ +          
Sbjct: 128 QRARVIIYAKDRFDPAGI-TSYADLADPALGNKICIRSSANVYNQSLVASRIAHLGVEAT 186

Query: 178 QDFIKNITAN 187
           +++++ + AN
Sbjct: 187 EEWVRGLMAN 196


>gi|84502993|ref|ZP_01001095.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Oceanicola batsensis HTCC2597]
 gi|84388738|gb|EAQ01609.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Oceanicola batsensis HTCC2597]
          Length = 336

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 75/183 (40%), Gaps = 8/183 (4%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY---TSSIQRPPI 68
            L G     +     + + LY+ +   ++ P+  +F E TG++++  +       +    
Sbjct: 8   ALAGGIALLAMPVAAQEVNLYSYRQPELLAPLTEAFTEETGIQVNVAHLDKGMVERLQAE 67

Query: 69  TQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLA 125
              SP D+++T D + LA   N  L   +    ++        + +     ++   +++ 
Sbjct: 68  GDRSPADLVLTVDISRLAAVVNAGLTQPVETETLEANVPDAYHDPDGHWWGLTTRARIVY 127

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            S  R+   ++  +  DL + +W+ R+   +  +     L++       +   +++++ +
Sbjct: 128 ASKDRVAEGEV-TTYEDLADPKWEGRICTRSGTHAYNVALVSAYLHHHGEEATREWLEGV 186

Query: 185 TAN 187
            +N
Sbjct: 187 KSN 189


>gi|133711187|gb|ABO36298.1| IdiA [Trichodesmium thiebautii II-3]
          Length = 173

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 74/165 (44%), Gaps = 9/165 (5%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDETSL- 85
           LY+ ++      +  SF ++TG+K++ I     +           SP DV +T D   L 
Sbjct: 2   LYSSRHYDTDQALYDSFTQKTGLKVNLIEGKGDKLIERIKSEGANSPADVFMTVDAGRLW 61

Query: 86  -ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDL 143
            A    +L  + +  +K K    L++        S   +V+ Y+  R++ +DL  +  DL
Sbjct: 62  RAQEAGILQPVSSSTLKTKIPASLRSPENLWFGFSKRARVIMYNKDRVQSSDL-STYEDL 120

Query: 144 TNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              +WK ++ I + +NI    L+ ++ +    +  + + K+  +N
Sbjct: 121 ATDKWKGKILIRSSSNIYNQSLIASLIEIHGMSDAESWAKDFVSN 165


>gi|126725354|ref|ZP_01741196.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacterales bacterium HTCC2150]
 gi|126704558|gb|EBA03649.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacterales bacterium HTCC2150]
          Length = 335

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 82/190 (43%), Gaps = 10/190 (5%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSI 63
           T+  + L     +         + + +Y+ +   ++ P+I  F   TG+K++  +    +
Sbjct: 2   TLAKFALSAALMSLPLCA--AAQEVNVYSHRQPDLIQPLIDGFTAETGIKVNVAFLAKGM 59

Query: 64  QRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
           +     +G  SP DV++T D + LA  ++  L   + + ++        ++   +   ++
Sbjct: 60  RERLAAEGSRSPADVVMTVDISRLAEVVDAGLTQAVTSDVLAANIPAEFRDPGNQWFGLT 119

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVV 177
              +V+  S  R+   ++  +  DLT+ +W  R+   +  N     L + +     + V 
Sbjct: 120 TRARVIYASRDRVAEGEV-TTYEDLTDPKWAGRICTRSGTNSYNIALTSAVIAHHGEEVA 178

Query: 178 QDFIKNITAN 187
            D++K + AN
Sbjct: 179 LDWLKGVKAN 188


>gi|294085659|ref|YP_003552419.1| family 1 extracellular solute-binding protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665234|gb|ADE40335.1| extracellular solute-binding protein family 1 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 343

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 83/184 (45%), Gaps = 8/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS---SIQRPP 67
           L + G             L +Y+ +   ++ P + +F   TG+K + ++ S   + +   
Sbjct: 12  LAMIGAVVFGHAAAHASELNIYSHRQAFLITPFLDAFTAETGIKTNVVFASKGLAQRLAA 71

Query: 68  ITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVL 124
               SP D+++T D   L+    + LL  + + ++ +     L++++     +S  ++++
Sbjct: 72  EGANSPADLVLTVDIARLSVYAEKGLLAPVQSDILNRVIPQHLRSQDGTWFGLSKRSRIV 131

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S  R+    + + + DL + +W+ ++   P +  ++  L+ +M     +   + + ++
Sbjct: 132 GVSKDRVAADAVLR-IEDLADPKWRGKICSRPGSHVYNRALVASMIAAHGEVKAEAWARD 190

Query: 184 ITAN 187
           + AN
Sbjct: 191 LVAN 194


>gi|39937212|ref|NP_949488.1| family 1 extracellular solute-binding protein [Rhodopseudomonas
           palustris CGA009]
 gi|39651070|emb|CAE29593.1| periplasmic iron binding protein FbpA precursor [Rhodopseudomonas
           palustris CGA009]
          Length = 336

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 80/173 (46%), Gaps = 9/173 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPITQG--SPVDVII 78
                + + +YT +   ++ P+  +F + TG+ ++ I  SS +++    +G  SP DV++
Sbjct: 19  AAGAAEQVNVYTYRETKLVQPLFDAFTKDTGIAVNVISASSGLEQRIKAEGADSPADVLL 78

Query: 79  TKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D   +  A+   +   + + +I +      ++ N +   IS   +V+  S  R+K   
Sbjct: 79  TVDIGRIDDAVAAGISQPINSAVIDEIVPAQFRDPNGQWAGISMRARVIYASKDRVKQEA 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  +  +L + +WK ++ I    +I  + L         +   +++++ + AN
Sbjct: 139 I--TYEELADPKWKGKICIRSGQHIYNNALFAAYVAKYGEAKAEEWLRGLKAN 189


>gi|323488303|ref|ZP_08093552.1| iron ABC transporter substrate-binding protein [Planococcus
           donghaensis MPA1U2]
 gi|323398055|gb|EGA90852.1| iron ABC transporter substrate-binding protein [Planococcus
           donghaensis MPA1U2]
          Length = 339

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 76/190 (40%), Gaps = 12/190 (6%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS---I 63
             + +  CG  E  S    +K L++Y+     ++ PI+  F++RTG+K+  +   +   +
Sbjct: 13  LLFTIAACGSDENESEATDSKTLSVYSPHQSEIINPIVKEFQDRTGIKVELVQGGTGELL 72

Query: 64  QRPPITQGSP-VDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQ 122
            R      +P  D+       SL    +          +    V K+E       S    
Sbjct: 73  SRVSAEAKNPGADIFWGGGAESLEAFGENFEPYITKEDEMIPDVFKSETGVWTGFSALPM 132

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIA---PNNISFHRLLNTMEQTP-----NK 174
           V+ Y+   ++ +D+P S   L + +WK +++      +  S+ +L+  +           
Sbjct: 133 VIMYNEDMVEESDVPASWEALIDEKWKGKIAFTDPNKSGSSYTQLVTMLTAYEDDGDNGW 192

Query: 175 TVVQDFIKNI 184
             V DF+ N+
Sbjct: 193 NFVNDFVANL 202


>gi|317052250|ref|YP_004113366.1| family 1 extracellular solute-binding protein [Desulfurispirillum
           indicum S5]
 gi|316947334|gb|ADU66810.1| extracellular solute-binding protein family 1 [Desulfurispirillum
           indicum S5]
          Length = 336

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 83/199 (41%), Gaps = 14/199 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+ +Y+ LL L     A+S     + + +Y+ +   +M P++  F+  TG+    +  +
Sbjct: 1   MKKILYSVLLALVCTAVAWS-----QVVNVYSYRQTHLMEPLLEEFKRETGIDYRLLTGA 55

Query: 62  SIQR----PPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIK-KNSFVLKNENKKL 114
           +             SP DV+IT D  +L       +L  + + ++        ++ + + 
Sbjct: 56  AGGLLERLVREGANSPADVLITVDAGNLVAAKQAGVLRSIESDILDVSIPAHYRDADGQW 115

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             +S  ++V+ Y+  RI  A +  S   L + +  KR+ + + +N+    L+  M     
Sbjct: 116 YGLSARSRVIYYAPDRIDPAQI-SSYEALADPKLGKRICVRSSSNVYNQSLMAAMIAHHG 174

Query: 174 KTVVQDFIKNITANEILTK 192
               +++ + +  N     
Sbjct: 175 AAKAEEWARGLVNNFARQP 193


>gi|158333301|ref|YP_001514473.1| iron deficiency induced protein A [Acaryochloris marina MBIC11017]
 gi|158303542|gb|ABW25159.1| iron deficiency induced protein A [Acaryochloris marina MBIC11017]
          Length = 350

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 86/191 (45%), Gaps = 9/191 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-- 62
           ++  + + +        T+   K + +Y+ ++      +   F ++TG+++  + +    
Sbjct: 13  SVSFFSIAVASGCTNTQTDGEGKIVRVYSARHYDTDQALYQDFTKQTGIEVKLLESKDNE 72

Query: 63  -IQRPPITQGSP-VDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRI 117
            ++R      +P  DV+IT D   L  A   +LL  + ++ +  K    L++ +     +
Sbjct: 73  LLERIKNEASNPQADVLITVDAGRLWRAEQANLLQSISSNQLKDKIPENLRHPDGLWFGL 132

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTV 176
           +   ++L Y+  ++K  +L  +   L    WK R+ +  + NI    LL +  ++  +T 
Sbjct: 133 TRRVRMLVYNKAKVKPEEL-STYEALAEPAWKGRVCVRSSNNIYNQSLLGSFIESKGETE 191

Query: 177 VQDFIKNITAN 187
            + + KN+ AN
Sbjct: 192 TEQWAKNLVAN 202


>gi|149180748|ref|ZP_01859251.1| ferric iron uptake ABC transporter (FeT) family, periplasmic
           substrate binding protein [Bacillus sp. SG-1]
 gi|148851538|gb|EDL65685.1| ferric iron uptake ABC transporter (FeT) family, periplasmic
           substrate binding protein [Bacillus sp. SG-1]
          Length = 386

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 75/175 (42%), Gaps = 9/175 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDV 76
                +  + +YT ++      I   FEE TG+K++ I     +         + +  DV
Sbjct: 65  QEVTDSGEVNVYTARHYDTDDAIYKKFEEETGIKVNVIKGEGDELMERLKREGEATEGDV 124

Query: 77  IITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
            IT D  +L  A    LL  + +  +       L++ + + + ++   +V+ YS  R+  
Sbjct: 125 FITADAGNLHKAKEAGLLQSIESETVNSNIDENLRDTDNQWVALTQRGRVIVYSKDRVDP 184

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++L  +  DLTN +W  ++ I  + NI    L+ +  +   +   +++   I  N
Sbjct: 185 SEL-STYEDLTNEKWNGKVLIRSSENIYNQSLMASFIELHGEEKAKEWAAGIVEN 238


>gi|144897381|emb|CAM74245.1| Bacterial extracellular solute-binding protein, family 1
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 338

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 39/195 (20%), Positives = 82/195 (42%), Gaps = 15/195 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           +F R   T    +   T + +       + +Y+ +   ++ P++ +F + +G+K++ +  
Sbjct: 3   LFSRLALTVAACMAAGTVSAA------EVNVYSARKDHLLKPVLDAFTQSSGIKVNLLSA 56

Query: 61  SSIQRP----PITQGSPVDVIITKDETSLALN--EDLLHKLPAHLIKK-NSFVLKNENKK 113
           +  Q         + SP D+ IT D   L       +L  + + ++ K       +    
Sbjct: 57  NETQLLERLKSEGKDSPADLFITTDVAHLHAARVAGILAPVQSAVLAKNIPAQYHDPQGY 116

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTP 172
              +S   +V+ Y+  R+K ADL  +  DL  A WK R+ +  ++ ++   LL  +    
Sbjct: 117 WYGLSARARVIFYAKDRVKPADL-STYEDLATATWKGRICVRSSSSTYNQSLLGGLIAVM 175

Query: 173 NKTVVQDFIKNITAN 187
                + + K IT N
Sbjct: 176 GPEKAEAWAKGITDN 190


>gi|300711289|ref|YP_003737103.1| ABC-type iron(III) transport system,substrate-binding protein
           [Halalkalicoccus jeotgali B3]
 gi|299124972|gb|ADJ15311.1| ABC-type iron(III) transport system,substrate-binding protein
           [Halalkalicoccus jeotgali B3]
          Length = 380

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 73/184 (39%), Gaps = 11/184 (5%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPII---HSFEERTGVKISPIYTSSIQRPPITQG 71
           G T           LTLY+ +N+ ++  ++           +++    ++ +    +++G
Sbjct: 64  GGTPMEEMPALEGELTLYSGRNEFLIGDLVNYIDDLYGDFSMEVRYGNSADLVNQILSEG 123

Query: 72  S--PVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
           S  P DV  + +  SL    +E     LP  L+         E+   + IS   + + Y+
Sbjct: 124 SGTPADVFYSVNAGSLGVLADEGRTQSLPEDLVGVVPEEFATED--WIGISGRARTVPYN 181

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           T+ +   ++P  +      ++   L  AP+  S    +  M     +   + +++++  N
Sbjct: 182 TEALSAEEMPSDI--YAYEEFGADLGWAPSYGSCQAFVTAMRLLQGEERARQWVESVVEN 239

Query: 188 EILT 191
            I +
Sbjct: 240 GIAS 243


>gi|40062841|gb|AAR37718.1| iron ABC transporter, iron-binding protein, putative [uncultured
           marine bacterium 441]
          Length = 338

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 85/193 (44%), Gaps = 13/193 (6%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKIS--PIYTSSI 63
           I + ++           +  T  +T+Y+ + + ++ P+   F ++TG++++        +
Sbjct: 8   ILSLVVSTLTMGSITQIQAATDDVTVYSSRKEHLIQPLFEQFTKQTGIEVNYLTGSGGDL 67

Query: 64  QRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVL-KNENKKLMRIS 118
                 +G  +P D+ +T D   L  A  +D+   +   +++ N     ++ N     +S
Sbjct: 68  IERLKLEGANTPADMFMTVDAGDLWYAGTQDIFQPIVTDVLESNIPSYLRDPNGLWTGLS 127

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPN-KTV 176
              + + YST R+  +DL  +  DL +++W K+L +  +   +   L+ ++      +  
Sbjct: 128 VRARTIVYSTDRVSESDL-STYGDLASSKWNKKLCLRTSKKIYTKSLVASIIHNKGVEDA 186

Query: 177 VQ---DFIKNITA 186
            +    ++ N+ A
Sbjct: 187 AEIIDGWVNNLAA 199


>gi|119475448|ref|ZP_01615801.1| extracellular solute-binding protein, family 1 [marine gamma
           proteobacterium HTCC2143]
 gi|119451651|gb|EAW32884.1| extracellular solute-binding protein, family 1 [marine gamma
           proteobacterium HTCC2143]
          Length = 358

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 77/183 (42%), Gaps = 9/183 (4%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPV 74
           A +       L +Y+ + + ++ P+   F  +TG+ ++ +   +     +       SP 
Sbjct: 36  ATADVLELPELLVYSARKEHLIKPLFDQFTAQTGIPVNYVTDKAGPLLARLQAEGDNSPA 95

Query: 75  DVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           D++IT D  +L  A    +L  L + ++       L++EN     ++   + + YS+ ++
Sbjct: 96  DILITVDAGNLWQATQVGVLAPLTSAVLAANVPSNLRDENNHWFALTIRARTIVYSSTKL 155

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEIL 190
              +L  +   L +A+W  RL +  +   +   L+ TM     +   +  +    AN  L
Sbjct: 156 APEEL-STYEALADAEWNDRLCLRTSKKVYNQSLVATMIAALGEARAEVVVAGWVANLAL 214

Query: 191 TKY 193
             +
Sbjct: 215 DPF 217


>gi|58584655|ref|YP_198228.1| ABC-type Fe3+ transport system, periplasmic component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418971|gb|AAW70986.1| ABC-type Fe3+ transport system, periplasmic component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 343

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 75/166 (45%), Gaps = 6/166 (3%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ-GSPVDVIITKDETSL 85
           + + +Y+ + + ++  +   F   TG+K+  I     Q     + GS  DV +T D  +L
Sbjct: 31  QVVNVYSSRKEELVRTLFDEFTRNTGIKVRYIIDDYSQLLSRMENGSGTDVFLTADAVNL 90

Query: 86  ALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFD 142
            L +   LL ++ + ++K+      ++       ++  T++L Y+ + +   DL  +  D
Sbjct: 91  ILAKKRGLLSQVNSEILKRAIPEKFRDSEGYWFGLTKRTRILVYNKESVDPKDL-STYED 149

Query: 143 LTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L N +WK ++ + +  +     L+  M         ++++  I +N
Sbjct: 150 LANKKWKGKILVRSSTSPYNRSLIAFMIANNGFEKTKEWVSGIVSN 195


>gi|86606749|ref|YP_475512.1| iron ABC transporter substrate-binding protein [Synechococcus sp.
           JA-3-3Ab]
 gi|86555291|gb|ABD00249.1| ferric iron uptake ABC transporter (FeT) family, substrate binding
           protein [Synechococcus sp. JA-3-3Ab]
          Length = 348

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 30/190 (15%), Positives = 77/190 (40%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR 65
                + L   +         + + LYT ++      +   F+++TG+ ++ +  ++ + 
Sbjct: 12  AALGSVALAAGSLGRPARGANREVNLYTSRHYGTDEKLYDLFKQKTGITVNWVQGNADEI 71

Query: 66  P----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRIS 118
                     SP D+ +T D   L  A NE L   + +  + K     L++       ++
Sbjct: 72  VQRIRSEGSNSPADIFMTVDVARLWRAQNEGLFQPIQSETLSKNIPESLRDPEGYWFGLT 131

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQTPNKTVV 177
              +V+ Y+  ++   +L  +  DL N +W+ ++ + + +N+    L  ++         
Sbjct: 132 KRARVIMYNKDKVDPKEL-STYEDLANPKWRGKVLTRSSSNVYSQSLTASIILAHGIPET 190

Query: 178 QDFIKNITAN 187
           + + + + AN
Sbjct: 191 EKWARGLVAN 200


>gi|148244799|ref|YP_001219493.1| iron ABC transporter substrate-binding protein [Candidatus
           Vesicomyosocius okutanii HA]
 gi|146326626|dbj|BAF61769.1| iron ABC transporter substrate-binding protein [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 339

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 77/194 (39%), Gaps = 9/194 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP 66
              +LLL   +   +   +   +T+Y+ + + ++ P+  SF   TG++++ +        
Sbjct: 10  ALIVLLLVVTSVGIARARSEDLVTVYSSRKEHLIKPLFESFTRDTGIQVTYLTGKGGALI 69

Query: 67  ----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISF 119
                  + +  D+ +T D  +L  A  +DL   +    ++      L++       +S 
Sbjct: 70  ERLKLEGKNTNADMFMTVDAGNLWYAATQDLFQAVQTQTLENNIPSHLRDSKGLWTGLSV 129

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQ 178
             + + YST+R+   DL  +  +L + +W  RL +  +   +   L+ +M          
Sbjct: 130 RARTIVYSTERVNPVDL-STYENLADTKWAGRLCLRTSKKIYTKSLVASMIYHHGINKAS 188

Query: 179 DFIKNITANEILTK 192
           D I     N   T 
Sbjct: 189 DIISGWVNNLAATP 202


>gi|117618651|ref|YP_855192.1| iron binding protein FbpA [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560058|gb|ABK37006.1| iron binding protein FbpA [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 335

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 84/185 (45%), Gaps = 8/185 (4%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPIT 69
           +L L        +      + +Y+++   ++ PII  FE+ +G+K++ ++        + 
Sbjct: 5   MLALAFSALVAQSALAAGEVNVYSNRQDELIKPIIQQFEKESGIKVNVVFAKEGLNERLE 64

Query: 70  -QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQV 123
            +G  SP D+++T D + L   +++ L+  + + ++ +    + ++ + +   ++   + 
Sbjct: 65  REGKLSPADLMLTVDISRLTDLVDKGLVQPVDSKILQENIPAIYRDPDNRWFALTTRVRA 124

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIK 182
           +  S  R+   D   S  DL   ++K ++        ++  L+++M         + +++
Sbjct: 125 IYSSKDRLGKLDTI-SYEDLAKPEFKGKICTRSGKHEYNVALVSSMIAHHGMAETRSWLE 183

Query: 183 NITAN 187
            + AN
Sbjct: 184 GVKAN 188


>gi|86610096|ref|YP_478858.1| iron ABC transporter periplasmic-binding protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86558638|gb|ABD03595.1| ferric iron uptake ABC transporter (FeT) family, periplasmic
           substrate binding protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 348

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 79/197 (40%), Gaps = 13/197 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFS----TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI 58
           +R   +   L      A S         + + LYT ++ S    +   F+++TG+ ++ +
Sbjct: 5   RRQFVSGATLGSAALAAGSLLRPAHGANREVNLYTSRHYSTDEKLYELFQQKTGITVNWV 64

Query: 59  YTSSIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNEN 111
              + +           SP D+ +T D   L  A NE     + +  + K     L++  
Sbjct: 65  QGKADEIIERIRSEGSNSPADIFMTVDVARLWRAQNEGWFQPIQSETLSKNIPESLRDPE 124

Query: 112 KKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQ 170
                ++   +V+ Y+  ++   +L  +  DL N +W+ ++ + + +N+    L  ++  
Sbjct: 125 GYWFGLTKRARVIMYNKDKVDPKEL-STYEDLANPKWRGKVLTRSSSNVYSQSLTASIIL 183

Query: 171 TPNKTVVQDFIKNITAN 187
                  + + + + AN
Sbjct: 184 AHGIPETEQWARGLVAN 200


>gi|84686950|ref|ZP_01014834.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84665147|gb|EAQ11627.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacterales bacterium HTCC2654]
          Length = 333

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 32/199 (16%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY- 59
           MF+ TI    L                 + +Y+ +   ++ P++ +F E TG++++  + 
Sbjct: 1   MFRTTITAACLAATAMPALA-------EVNVYSYRQPELIQPLVDAFTEDTGIEVNVAFL 53

Query: 60  --TSSIQRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKL 114
                 +     Q SP DVI+T D + LA  +  D+   + +  +  +    L++ + + 
Sbjct: 54  NTGMVERLQAEGQRSPADVILTTDISRLAELVAADVTQPVDSETLTTQIPENLRDPDNQW 113

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             ++   +V+  S +R+   ++  +  DL + +W+ R+   +  +     L +       
Sbjct: 114 FALTTRARVVYASKERVAEGEV-TTYEDLADPKWEGRICTRSGTHAYMVALTSAAIHHMG 172

Query: 174 KTVVQDFIKNITANEILTK 192
           +   + +++ + +N  +  
Sbjct: 173 EEGAKAWLEGVKSNLAMKP 191


>gi|219871315|ref|YP_002475690.1| periplasmic iron-binding protein [Haemophilus parasuis SH0165]
 gi|219691519|gb|ACL32742.1| periplasmic iron-binding protein [Haemophilus parasuis SH0165]
          Length = 341

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 82/188 (43%), Gaps = 11/188 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI---QR 65
            +L L   +   ++      + +Y+ +   ++ P++  FE++TG+K++ I+       + 
Sbjct: 6   SVLALALSSVISTSALAANEVNVYSYRQPYLIEPMLKDFEKQTGIKVNVIFADKGLVERV 65

Query: 66  PPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
               + SP DV++T D + +   +   L  K+ +  ++K      ++ N +   ++   +
Sbjct: 66  QKEGELSPADVLLTVDISRVMQIVKAGLAQKVDSKTLEKNIPAQFRDSNGEWFGLTKRAR 125

Query: 123 VLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQD 179
           V+  S  R+    LP      DL   ++K ++ +    N     L   M +   +   + 
Sbjct: 126 VIYTSKDRV--GALPAGFDYLDLAKPEYKGKVCVRSGKNAYNVSLFAAMIEHYGEEKTKA 183

Query: 180 FIKNITAN 187
           F++ + AN
Sbjct: 184 FLEGLKAN 191


>gi|167855400|ref|ZP_02478166.1| FbpA [Haemophilus parasuis 29755]
 gi|167853466|gb|EDS24714.1| FbpA [Haemophilus parasuis 29755]
          Length = 341

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 82/188 (43%), Gaps = 11/188 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI---QR 65
            +L L   +   ++      + +Y+ +   ++ P++  FE++TG+K++ I+       + 
Sbjct: 6   SVLALALSSVISTSALAANEVNVYSYRQPYLIEPMLKDFEKQTGIKVNVIFADKGLVERV 65

Query: 66  PPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
               + SP DV++T D + +   +   L  K+ +  ++K      ++ N +   ++   +
Sbjct: 66  QKEGELSPADVLLTVDISRVMQIVKAGLAQKVDSKTLEKNIPAQFRDSNGEWFGLTKRAR 125

Query: 123 VLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQD 179
           V+  S  R+    LP      DL   ++K ++ +    N     L   M +   +   + 
Sbjct: 126 VIYTSKDRV--GALPAGFDYLDLAKPEYKGKVCVRSGKNAYNVSLFAAMIEHYGEEKTKA 183

Query: 180 FIKNITAN 187
           F++ + AN
Sbjct: 184 FLEGLKAN 191


>gi|226310547|ref|YP_002770441.1| iron ABC transporter substrate binding protein [Brevibacillus
           brevis NBRC 100599]
 gi|226093495|dbj|BAH41937.1| probable iron ABC transporter substrate binding protein
           [Brevibacillus brevis NBRC 100599]
          Length = 362

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 85/206 (41%), Gaps = 20/206 (9%)

Query: 1   MFKRTIYTYLLLLCGFTEAFST-----------ENTTKYLTLYTDQNQSVMLPIIHSFEE 49
           M    +   +L  CG     +              T + + ++T ++  +   +   F +
Sbjct: 10  MLSTMLTLPILAACGNGANTAQPQTEAPKAQEPAATEQVVNVFTARHYDIDSKLFAEFTK 69

Query: 50  RTGVKISPIYTSSIQRP----PITQGSPVDVIITKDETSL--ALNEDLLHKL-PAHLIKK 102
           +TG+K++ +  ++ +         + S  D+ IT D   L  A    +L  +  A + K 
Sbjct: 70  QTGIKVNEVKGTAEELVERLKREGESSEADLFITVDGGVLNYAKQNGVLQPIQSAEVEKN 129

Query: 103 NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISF 161
               L++ + + + ++   +V+ Y+  R+K   L  +  DL   +WK ++ + + +N+  
Sbjct: 130 VPKELRDPDNQWIGMATRARVIVYAKDRVKPEQL-STYEDLATDKWKGKVLVRSSSNLYN 188

Query: 162 HRLLNTMEQTPNKTVVQDFIKNITAN 187
             L+ +  +   +    D+ K +  N
Sbjct: 189 QSLVASFIELNGEQAALDWAKGLVNN 214


>gi|255264726|ref|ZP_05344068.1| extracellular solute-binding protein, family 1 [Thalassiobium sp.
           R2A62]
 gi|255107061|gb|EET49735.1| extracellular solute-binding protein, family 1 [Thalassiobium sp.
           R2A62]
          Length = 334

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 79/194 (40%), Gaps = 14/194 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY- 59
           M + +I++  L                 + +Y+ +   ++ P+  +F   TG+ ++  Y 
Sbjct: 1   MLRSSIFSLTLSALAMPV------IADEVNIYSYRQPELLAPLTDAFTAETGIDVNVAYL 54

Query: 60  --TSSIQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKL 114
                 +       SP DVI+T D + L  A+N  +   + + ++       L++   + 
Sbjct: 55  AKGMIERLQAEGDRSPADVILTVDISRLTDAVNAGVTQPVTSDVLTANVPAELRDPEGQW 114

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             ++   +++  S + +   ++  +  DL + +W+ R+   +  +     L+  M     
Sbjct: 115 FGVTTRARIVYASKENVADGEI-TTYEDLADPKWEGRICTRSGTHAYTLALVAGMLHHHG 173

Query: 174 KTVVQDFIKNITAN 187
           +   + +++ + +N
Sbjct: 174 EEETRTWLEGVKSN 187


>gi|149927268|ref|ZP_01915524.1| ABC transporter, iron binding protein [Limnobacter sp. MED105]
 gi|149823982|gb|EDM83205.1| ABC transporter, iron binding protein [Limnobacter sp. MED105]
          Length = 338

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 79/190 (41%), Gaps = 9/190 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISP---IYTSS 62
             T  L           +   + +T+Y+ + + ++ P +  + + TGVKI+       S 
Sbjct: 4   AITATLCAVLLPGLAQAQKKPEEVTVYSSRIEQLLKPTLDQYTQETGVKINLLTDRGGSL 63

Query: 63  IQRPPIT-QGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKKNSFVL-KNENKKLMRIS 118
            +R     + SP DV+IT D  +L  A    LL K+ + ++  N     ++  ++   +S
Sbjct: 64  TERLNAEGKSSPADVLITVDMGNLWNAAERGLLRKMDSPVLNANVPDYLRDPGQRWYGLS 123

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVV 177
              + + Y+  R+   +L  +  DL   +WK +L +  +  ++   L+  +     +   
Sbjct: 124 KRERTIFYAAGRVDPKNL-STYEDLAQPKWKGKLCLRTSKQTYTQSLVAMLIAKHGEAKA 182

Query: 178 QDFIKNITAN 187
           +   +    N
Sbjct: 183 EQIARGWVNN 192


>gi|315636495|ref|ZP_07891731.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
 gi|315479144|gb|EFU69841.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
          Length = 350

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 80/195 (41%), Gaps = 16/195 (8%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M K+   + +LL        S+      + +Y+ ++      I   FE+ TG+K++ I  
Sbjct: 16  MIKKLTLSTILLA-------SSLFGANEVNVYSQRHYDSDKIIYKKFEQETGIKVNVITA 68

Query: 61  SSIQR----PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKK 113
            + +           +P DV+IT D  +L  A    LL  + + ++ +     L++ +  
Sbjct: 69  QAEELVAKLAIEGANTPADVLITADIGNLYQAKKRHLLQPIESKILTENVPEKLRDPDNN 128

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTP 172
              ++   +V  Y+ K++   DL      L + ++K + ++ +  +     LL ++    
Sbjct: 129 WFALTQRARVFVYNPKKVNPDDL-SDYLSLADPKFKDKIITRSSTSGYNKSLLASIIANY 187

Query: 173 NKTVVQDFIKNITAN 187
            +     F K +  N
Sbjct: 188 GEEKALAFAKGLVEN 202


>gi|218246286|ref|YP_002371657.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           8801]
 gi|218166764|gb|ACK65501.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8801]
          Length = 350

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 75/179 (41%), Gaps = 9/179 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVI 77
           +    + + +Y+ ++ +    +  +F  +TG+K++ I   +           + S  D++
Sbjct: 30  SSAQNREVNVYSSRHYNTDSRLYENFTRQTGIKVNLIEGEADPLIERIKSEGKNSKADIL 89

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           IT D   L  A    +   + + ++++     L++        S   +V+ YS  R+  +
Sbjct: 90  ITVDAGRLWRADQAGIFAPVNSKILQQKIPASLRHPKGHWFGFSKRLRVIMYSKARVNPS 149

Query: 135 DLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            L  +  DL N +WK + ++ +  NI    L + M     +   + + + + AN   + 
Sbjct: 150 QL-STYEDLANPKWKGKVITRSSTNIYSQSLCSWMIAVNGQGATEKWCRGLVANFARSP 207


>gi|257059333|ref|YP_003137221.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
 gi|256589499|gb|ACV00386.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
          Length = 350

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 75/179 (41%), Gaps = 9/179 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVI 77
           +    + + +Y+ ++ +    +  +F  +TG+K++ I   +           + S  D++
Sbjct: 30  SSAQNREVNVYSSRHYNTDSRLYENFTRQTGIKVNLIEGEADPLIERIKSEGKNSKADIL 89

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           IT D   L  A    +   + + ++++     L++        S   +V+ YS  R+  +
Sbjct: 90  ITVDAGRLWRADQAGIFAPVNSKILQQKIPASLRHPKGHWFGFSKRLRVIMYSKARVNPS 149

Query: 135 DLPKSVFDLTNAQWKKR-LSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192
            L  +  DL N +WK + ++ +  NI    L + M     +   + + + + AN   + 
Sbjct: 150 QL-STYEDLANPKWKGKVITRSSTNIYSQSLCSWMIAVNGQGATEKWCRGLVANFARSP 207


>gi|118593592|ref|ZP_01550969.1| putative iron binding protein [Stappia aggregata IAM 12614]
 gi|118433810|gb|EAV40470.1| putative iron binding protein [Stappia aggregata IAM 12614]
          Length = 347

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 30/190 (15%), Positives = 78/190 (41%), Gaps = 9/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-I 63
            I     LL   T +         + +Y+ +   ++ P++ +F + TG+K + ++ +  +
Sbjct: 6   RILAGAALLSSATLSAVPAFADGEVNIYSYRQPYLIEPLLDAFTKETGIKTNVVFAAEGL 65

Query: 64  QRPPITQG--SPVDVIITKDETSLALNEDLL--HKLPAHLIKK-NSFVLKNENKKLMRIS 118
                 +G  SP DV++T D   L   + L     + + ++        ++     + ++
Sbjct: 66  GERIAAEGANSPADVLLTVDIGRLDGAKQLGISQPVESDIVNANVPAEFRDPEGHWIGLT 125

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVV 177
              +V+  S +R++   +  +  +L + +WK RL        +   L+ +M         
Sbjct: 126 NRARVIYASKERVEQDSI--TYEELADPKWKGRLCTRSGQHVYTVGLVASMVAHHGPEET 183

Query: 178 QDFIKNITAN 187
           + +++ +  N
Sbjct: 184 EKWLEGVRDN 193


>gi|58616850|ref|YP_196049.1| putative major ferric iron binding protein precursor [Ehrlichia
           ruminantium str. Gardel]
 gi|58416462|emb|CAI27575.1| Possible major ferric iron binding protein precursor [Ehrlichia
           ruminantium str. Gardel]
          Length = 365

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGSPVDVII 78
           +++ + + +Y+ + + ++  +   F + TG+K+  I   + Q         + +  DV +
Sbjct: 46  KDSLQEVHVYSSRKEELLQDLFEKFTKETGIKVKYIIDEAAQLINRMENEGEATSADVFL 105

Query: 79  TKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L  A  + LL  + + ++ +      ++ +     ++   +V+ Y+   ++  +
Sbjct: 106 TADAVNLILAKKKGLLQPIQSDVLTRAIPSKYRDHDGFWFGLTKRARVIVYNKNLVEDKE 165

Query: 136 LPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L N +WK ++ + + ++     L+  M         + +I+ +  N
Sbjct: 166 L-STYEHLANRKWKDKILVRSSSSPYNQSLIAFMIANDGIENAKIWIRGLVDN 217


>gi|307947442|ref|ZP_07662775.1| iron uptake protein A1 [Roseibium sp. TrichSKD4]
 gi|307769260|gb|EFO28488.1| iron uptake protein A1 [Roseibium sp. TrichSKD4]
          Length = 347

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 78/190 (41%), Gaps = 9/190 (4%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS--- 61
              + L +L   T A         + +Y+ +   ++ P++ +F + TGVK + I+     
Sbjct: 6   RAASALFMLTAATTASMPALADGEVNIYSYRQPFLIQPLLDAFTQETGVKTNVIFAKKGL 65

Query: 62  SIQRPPITQGSPVDVIITKDETSLALNEDLL--HKLPAHLI-KKNSFVLKNENKKLMRIS 118
             +     + SP DV++T D   L   + L     + + ++ +      ++     + ++
Sbjct: 66  GERISAEGENSPADVLLTVDIGRLDGAKQLGITQPVSSDVVNENIPAQYRDPEGHWVGLT 125

Query: 119 FDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVV 177
              +++  S  R++   +  +  +L + +W+ ++        +   L+ +M     +   
Sbjct: 126 NRARIIYASKDRVQQDTI--TYEELADPKWQGKICTRSGQHVYTIGLIASMIAHHGEART 183

Query: 178 QDFIKNITAN 187
           ++++  +  N
Sbjct: 184 EEWLVGVRDN 193


>gi|58578791|ref|YP_197003.1| putative major ferric iron binding protein precursor [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417417|emb|CAI26621.1| Possible major ferric iron binding protein precursor [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 365

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGSPVDVII 78
           +++ + + +Y+ + + ++  +   F + TG+K+  I   + Q         + +  DV +
Sbjct: 46  KDSLQEVHVYSSRKEELLQDLFEKFTKETGIKVKYIIDEAAQLINRMENEGEATSADVFL 105

Query: 79  TKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L  A  + LL  + + ++ +      ++ +     ++   +V+ Y+   ++  +
Sbjct: 106 TADAVNLILAKKKGLLQPIQSDVLTRAIPSKYRDHDGFWFGLTKRARVIVYNKNLVEDKE 165

Query: 136 LPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L N +WK ++ + + ++     L+  M         + +I+ +  N
Sbjct: 166 L-STYEHLANRKWKDKILVRSSSSPYNQSLIAFMIANDGIENAKIWIRGLVDN 217


>gi|148656418|ref|YP_001276623.1| extracellular solute-binding protein [Roseiflexus sp. RS-1]
 gi|148568528|gb|ABQ90673.1| extracellular solute-binding protein, family 1 [Roseiflexus sp.
           RS-1]
          Length = 381

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 72/169 (42%), Gaps = 8/169 (4%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEER-TGVKISPIYTSSIQRPP---ITQGSP-VDVIITKD 81
             + +YT + +++  P+I +F      +K++ +  S+ +        + +P  DV+I  D
Sbjct: 72  GEVVVYTTRAEALFKPVIEAFNAAYPDIKVTVLNGSNSELAARILEERANPKADVLINSD 131

Query: 82  ETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             ++     E +     +  +       + ++   + ++   +V+ Y+T  +   +LPK 
Sbjct: 132 ILTMENLAAEGVFAPNNSPAVMAVPADYRADDGSWVALTLRARVIMYNTDLVSPEELPKK 191

Query: 140 VFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           + DL + +WK  +  A   N +    L  M     +   + FI+ +  N
Sbjct: 192 MVDLADPKWKDVIGSANSTNGAMMAQLVIMRNQLGEPATEAFIQGLLEN 240


>gi|127511795|ref|YP_001092992.1| extracellular solute-binding protein [Shewanella loihica PV-4]
 gi|126637090|gb|ABO22733.1| extracellular solute-binding protein, family 1 [Shewanella loihica
           PV-4]
          Length = 335

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 85/184 (46%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
           L + GF    S  N    +T+Y+ +   ++ PI+  F + TG+K++ ++T   I      
Sbjct: 7   LAVLGFACVTSMANAADSITVYSYRQAFLIDPILADFTKETGIKVNLVFTKQGIAERIAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L    ++ L+  + +  + +     L++ N     ++   + +
Sbjct: 67  EGRLSPADLVLTSDFSRLMELADKGLVASVDSQTLAQNIPANLRSPNGDWFALTKRVRNI 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S +R+   D+     DL + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YSSKERLGPLDI--DYEDLADPKFKGKICTRSGKHPYNISLVASMIAHHGEADTKTWLEG 184

Query: 184 ITAN 187
           + AN
Sbjct: 185 VKAN 188


>gi|170724178|ref|YP_001751866.1| extracellular solute-binding protein [Pseudomonas putida W619]
 gi|169762181|gb|ACA75497.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           W619]
          Length = 333

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++   TGVKI  I               +    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAETGVKIKFITDKEAPLMQRIKAEGENGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I +      +  +     +S   + + YST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIKSAIIDQNIPAQYRASSHDWTGLSLRARTIIYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            A+L  +   L + QW+ RL +      +   L  T+ +   +   +  +K    N
Sbjct: 137 PAEL-STYEALADKQWEGRLCLRTAKKVYNQSLTATLIENHGEAKTEQIVKGWVNN 191


>gi|133711189|gb|ABO36299.1| IdiA [Trichodesmium spiralis KAT]
          Length = 173

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 73/165 (44%), Gaps = 9/165 (5%)

Query: 31  LYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDETSL- 85
           LY+ ++      +  SF ++TG+K++ I     +           S  DV +T D   L 
Sbjct: 2   LYSSRHYDTDQALYDSFTKKTGLKVNLIEGKGDKLIERIRSEGANSSADVFMTVDAGRLW 61

Query: 86  -ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDL 143
            A    +L  + +  +K K    L++        S   +V+ Y+  R++ +DL  +  DL
Sbjct: 62  RAQEAGVLQPVSSSTLKTKIPASLRSPENLWFGFSKRARVIMYNKDRVQSSDL-STYEDL 120

Query: 144 TNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
              +WK ++ I + +NI    L+ ++ +    +  + + K+  +N
Sbjct: 121 ATDKWKGKILIRSSSNIYNQSLIASLIEIHGMSDAESWAKDFVSN 165


>gi|328545131|ref|YP_004305240.1| Fe3+ ABC transporter [polymorphum gilvum SL003B-26A1]
 gi|326414873|gb|ADZ71936.1| Fe3+ ABC transporter [Polymorphum gilvum SL003B-26A1]
          Length = 350

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 75/192 (39%), Gaps = 10/192 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTEN-TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           R++    L+         T       + +Y+ +   ++ P++ +F   TGVK + IY + 
Sbjct: 7   RSLANAALVATALVSLTGTVARADGEVNIYSYRQPFLIQPLLDAFTTETGVKTNVIYAAD 66

Query: 63  I---QRPPITQGSPVDVIITKDETSLALNEDLL--HKLPAHLIKK-NSFVLKNENKKLMR 116
               +       SP DV+++ D   L   + L     + + ++        ++     + 
Sbjct: 67  GLDERIAAEGANSPADVLLSVDIGRLDGAKQLGITQPVTSDVVNANIPATYRDPEGHWVG 126

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           ++   +V+  S  R++   +  +  +L + +WK R+        ++  L+ +M       
Sbjct: 127 LTMRARVVYASKDRVEQDSI--TYEELADPKWKGRICTRSGQHVYNIGLIASMLAHHGAE 184

Query: 176 VVQDFIKNITAN 187
             + ++  +  N
Sbjct: 185 ETEKWLAGVRDN 196


>gi|269101790|ref|ZP_06154487.1| ferric iron ABC transporter iron-binding protein [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161688|gb|EEZ40184.1| ferric iron ABC transporter iron-binding protein [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 337

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 31/195 (15%), Positives = 83/195 (42%), Gaps = 14/195 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+ + + +L      +        + + +Y+ +   ++ P+   F + TG+K++  +  
Sbjct: 1   MKKLLASAILAGLAVPQM---ATAAEEVNVYSYRQPFLVEPMFKEFTKETGIKVNVKFAK 57

Query: 62  S-IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DV++T D + L    ++ L+  +   +I+       ++   +  
Sbjct: 58  EGLAEKLQQEGEYSPADVVLTTDISRLVELSDKKLVQAVDNKVIEANVPAQYRDSEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++   + +  S  R+    LP+S    DL   +WK ++        ++  L+++M    
Sbjct: 118 ALTLRARNVYSSKDRV--GQLPESFDYLDLAKPEWKGKICTRSGKHPYNVSLVSSMIAHY 175

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ + AN
Sbjct: 176 GEAETKQWLEGVKAN 190


>gi|222478600|ref|YP_002564837.1| ABC-type iron(III) transport system,substrate-binding protein
           [Halorubrum lacusprofundi ATCC 49239]
 gi|222451502|gb|ACM55767.1| ABC-type iron(III) transport system,substrate-binding protein
           [Halorubrum lacusprofundi ATCC 49239]
          Length = 385

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 63/179 (35%), Gaps = 10/179 (5%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEER-TGVKISPIYTSSI----QRPPIT 69
           G        +    LT+Y+ + + ++  ++   E++     ++  Y  S     Q     
Sbjct: 69  GGIPMAEMPDLEGELTVYSGRGEFLVGELVEYIEDQYDDFDLTVRYAGSTDLVNQILNEG 128

Query: 70  QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
            GSP DV  + +  SL     E     L + +        + E  + +  S   + + Y+
Sbjct: 129 DGSPADVFYSVNAGSLGTLAGEGRSQALSSEITDMVRSEFRTE--QWIGTSGRARTVPYN 186

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITA 186
           T      DLP  +      ++   L  AP+  S    +  M     +     +++++  
Sbjct: 187 TGEFSDDDLPDDIMAYP-EEFAGSLGWAPSYGSCQAFITAMRLIEGEEATLAWLESVVE 244


>gi|332307090|ref|YP_004434941.1| extracellular solute-binding protein family 1 [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332174419|gb|AEE23673.1| extracellular solute-binding protein family 1 [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 338

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 86/199 (43%), Gaps = 12/199 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            KR +    L+ C    AF++    + + +Y+ + ++++ P++  F   TG+ ++ +   
Sbjct: 1   MKRFLKLVGLVSCISVSAFAS---AQEVNVYSARKEALIKPLLDKFSADTGISVNLVTGK 57

Query: 62  SIQRP--PITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKL 114
           +        ++G  SP D++IT D   L  A  + L   +     K   S    + +   
Sbjct: 58  ADALITRLKSEGKYSPADILITTDVGRLYRAKEQGLTQAIETDAFKGLISQNYIDPDSNW 117

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
           +  +   + L  + +R+  + L + + DL + QW+ R+ I + +NI    ++  M     
Sbjct: 118 VGFTLRARPLMVAPERVDASQLSR-MEDLADEQWRGRICIRSSSNIYNQSMVAAMIAQLG 176

Query: 174 KTVVQDFIKNITANEILTK 192
           +   Q ++ +   N   T 
Sbjct: 177 EEKTQAWLNDFVKNFARTP 195


>gi|256828551|ref|YP_003157279.1| family 1 extracellular solute-binding protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577727|gb|ACU88863.1| extracellular solute-binding protein family 1 [Desulfomicrobium
           baculatum DSM 4028]
          Length = 333

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQRPPITQGSPVDVIITKDET 83
            L +Y+ + + ++ P+  ++  +TGVKI  +         +     + +P D++IT D  
Sbjct: 25  ELVVYSARAEQLIKPLFDAYTAKTGVKIQYVTDKEPVLLERLKAEGERTPADMLITVDAG 84

Query: 84  SLAL--NEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140
           +L L     ++  + +  +       L++   K   +S   + + Y+T ++K ADL  + 
Sbjct: 85  NLWLAGEAGVISPVQSETLAANIPDHLRDPGNKWFGLSLRARTIVYNTGKVKPADL-STY 143

Query: 141 FDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITANEILTKY 193
             L   +WK RL +  +   +   L+  +     +   +  +    AN  +  +
Sbjct: 144 AALAGPEWKGRLLLRTSKKVYNQSLVAALIAELGEAEAERVVAGWVANTPVAPF 197


>gi|325291642|ref|YP_004277506.1| iron ABC transporter substrate-binding protein [Agrobacterium sp.
           H13-3]
 gi|325059495|gb|ADY63186.1| iron ABC transporter, substrate binding protein [Agrobacterium sp.
           H13-3]
          Length = 349

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 84/194 (43%), Gaps = 14/194 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-T 60
           F   +++ L +L     AF+       + +Y+ +   ++ P++ +F + TG++ + ++  
Sbjct: 8   FSAAVFSGLTILSAAPAAFA----GGEVNVYSYRQPELIQPLLDAFTKETGIEANVLFLD 63

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLALNE--DLLHKL--PAHLIKKNSFVLKNENKKL 114
             +      +G  SP DV++T D   L   +   +   +     + K     L++   + 
Sbjct: 64  KGLVERIQAEGVNSPADVLLTVDIARLVEAKEGGVTQPVLNDPVIEKDIPANLRDPQGEW 123

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPN 173
             ++   +V+  S +R+   D+  +  +L + +WK ++ I     S++  L+ +M     
Sbjct: 124 FGLTTRGRVVYASKERVTQKDI--TYEELADPKWKGKICIRDGQHSYNIALIASMIAHHG 181

Query: 174 KTVVQDFIKNITAN 187
               + ++  +  N
Sbjct: 182 VDYTRTWLTGLKNN 195


>gi|157738208|ref|YP_001490892.1| putative iron-uptake ABC transporter, periplasmic iron-binding
           protein [Arcobacter butzleri RM4018]
 gi|157700062|gb|ABV68222.1| putative iron-uptake ABC transporter, periplasmic iron-binding
           protein [Arcobacter butzleri RM4018]
          Length = 335

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 80/195 (41%), Gaps = 16/195 (8%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M K+   + +LL        S+      + +Y+ ++      I   FE+ TG+K++ I  
Sbjct: 1   MIKKLTLSTILLA-------SSLFGANEVNVYSQRHYDSDKIIYKKFEQETGIKVNVITA 53

Query: 61  SSIQR----PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKK 113
            + +           +P DV+IT D  +L  A    LL  + + ++ +     L++ +  
Sbjct: 54  QAEELVAKLAIEGANTPADVLITADIGNLYQAKKRHLLQPIESKILTENVPEKLRDPDNN 113

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQTP 172
              ++   +V  Y+ K++   DL      L + ++K ++ + +  +     LL ++    
Sbjct: 114 WFALTQRARVFVYNPKKVNPDDL-SDYLSLADPKFKNKIVTRSSTSGYNKSLLASIIANY 172

Query: 173 NKTVVQDFIKNITAN 187
            +     F K +  N
Sbjct: 173 GEEKALAFAKGLVEN 187


>gi|156743114|ref|YP_001433243.1| extracellular solute-binding protein [Roseiflexus castenholzii DSM
           13941]
 gi|156234442|gb|ABU59225.1| extracellular solute-binding protein family 1 [Roseiflexus
           castenholzii DSM 13941]
          Length = 382

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 72/179 (40%), Gaps = 8/179 (4%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEE-RTGVKISPIYTSSIQRPP---ITQGS 72
                       + +YT + +++  P+I +F      VK++ +  S+ +        + +
Sbjct: 63  PTGAPVAAPKGEVIVYTSRAEALFKPVIEAFNAVYPDVKVTVLNGSNSELAARILEERAN 122

Query: 73  P-VDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           P  DV+I  D  ++     E +     +  +       + ++   + ++   +V+ Y+T 
Sbjct: 123 PQADVLINSDILTMENLAAEGVFAPNDSPAVMAVPADYRADDGSWVALTLRARVIMYNTD 182

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +   +LPK + DL + +WK  L  A   N +    L  M     +   + FI+ +  N
Sbjct: 183 LVSPDELPKKMLDLADPKWKDVLGSANSTNGAMMAQLVVMRNQLGEAATEAFIQGLLEN 241


>gi|57238862|ref|YP_179998.1| putative major ferric iron binding protein precursor [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57160941|emb|CAH57847.1| putative iron-binding periplasmic protein [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 348

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGSPVDVII 78
           +++ + + +Y+ + + ++  +   F + TG+K+  I   + Q         + +  DV +
Sbjct: 29  KDSLQEVHVYSSRKEELLQDLFEKFTKETGIKVKYIIDEAAQLINRMENEGEATSADVFL 88

Query: 79  TKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L  A  + LL  + + ++ +      ++ +     ++   +V+ Y+   ++  +
Sbjct: 89  TADAVNLILAKKKGLLQPIQSDVLTRAIPSKYRDHDGFWFGLTKRARVIVYNKNLVEDKE 148

Query: 136 LPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L N +WK ++ + + ++     L+  M         + +I+ +  N
Sbjct: 149 L-STYEHLANRKWKDKILVRSSSSPYNQSLIAFMIANDGIENAKIWIRGLVDN 200


>gi|77461651|ref|YP_351158.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77385654|gb|ABA77167.1| putative iron (III) ABC transport system, substrate-binding protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 334

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 75/193 (38%), Gaps = 13/193 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           KR +    L L G T A         + +Y+ +   ++ P+  ++  +TGVKI  I    
Sbjct: 5   KRVLTALALTLIGSTAA----QAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKE 60

Query: 63  IQRP----PITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLM 115
                      + +  D+++T D  +L   E   +L    +  I        ++ +    
Sbjct: 61  APLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSKTIDANIPLQYRSSSHAWT 120

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNK 174
            +S   + +AYST+R+K  +L  +   L +  W+ RL +      +   L  TM +    
Sbjct: 121 GLSLRARTIAYSTERVKPGEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATMIEVHGA 179

Query: 175 TVVQDFIKNITAN 187
              +  +K    N
Sbjct: 180 EKTEQILKGWVNN 192


>gi|26991872|ref|NP_747297.1| iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
 gi|24986992|gb|AAN70761.1|AE016720_4 iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida KT2440]
          Length = 333

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++  +TGVKI  I                    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGDNGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I +      +  +     +S   + + YST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIESDVIDQNIPAQYRASSHDWTGLSLRARTIIYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L + QW+ RL +      +   L  T+ +T  +   +  +K    N
Sbjct: 137 PEEL-STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQIVKGWVNN 191


>gi|311696734|gb|ADP99607.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [marine bacterium HP15]
          Length = 340

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 25  TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQG--SPVDVIITK 80
           +   + LY+ ++      I ++F E TG+K++ I   S         +G  SP D++IT 
Sbjct: 23  SASEVNLYSARHYDSDQAIYNAFTEETGIKVNLIEGKSDALIQRIQREGVASPADILITV 82

Query: 81  DETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLP 137
           D  +L  A  E +   + + ++  +    L++        S   +V+ Y       + + 
Sbjct: 83  DAGNLWRADQEGIFQPVDSEVLNSRLPDSLRHPEGHWFGFSQRLRVIYYDRSDFDPSRIS 142

Query: 138 KSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +   DL   ++K  + I + +NI    LL ++ +   +   +++ + +  N
Sbjct: 143 Q-YEDLAKPEFKGEICIRSSSNIYNQSLLASLVEYHGEEGAEEWAQGVVNN 192


>gi|322371854|ref|ZP_08046397.1| iron-binding protein [Haladaptatus paucihalophilus DX253]
 gi|320548739|gb|EFW90410.1| iron-binding protein [Haladaptatus paucihalophilus DX253]
          Length = 391

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 65/149 (43%), Gaps = 8/149 (5%)

Query: 53  VKISPIYTSSIQRPPITQ----GSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKNSFV 106
           + +    ++S+    I +    GS  D+ ++ D  SL    +      LP +++ K    
Sbjct: 111 ILVKTDSSASLANTIIEENKGSGSRADLFLSIDAGSLGVVADSGATTALPQNVLTKVPEH 170

Query: 107 LKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTN-AQWKKRLSIAPNNISFHRLL 165
            +      + I    + + Y+T +   +D+P S+F L +  Q+K  +  AP+  +F   +
Sbjct: 171 YRGPKDSWVGIEGRARTIPYNTDKFSKSDIPDSIFALPDQQQFKNVMGWAPSYGAFQSFV 230

Query: 166 NTMEQTPNKTVVQDFIKNITANEILTKYK 194
             M     +   + ++K +   + +T+YK
Sbjct: 231 TAMRVLDGEKKTKAWLKGMQK-QGVTEYK 258


>gi|50120409|ref|YP_049576.1| ABC transporter substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610935|emb|CAG74380.1| ABC transporter, substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 349

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 79/195 (40%), Gaps = 16/195 (8%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YT 60
           K+     L        A         LTLYT +   ++ P++ +F + T VK++ +    
Sbjct: 10  KKARLLTLASSLMVAYALPAVAAEDSLTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKD 69

Query: 61  SSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMR 116
             ++R     Q SP D+++T D  +L   +   +   + +  +       L++++ +   
Sbjct: 70  GMLERVKAEGQNSPADLLMTVDAGNLIDLVEAGVTQPIQSSTLTDVIPAALRDKDNQWFG 129

Query: 117 ISFDTQVLAYSTKRIKIADLP---KSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTP 172
           +S  ++VL           LP    +  +L + +WK ++ I A  +     L+  M    
Sbjct: 130 LSMRSRVL------YAEKSLPLTGITYENLADPKWKGKVCIRAGQHPYNTALVAAMIAHH 183

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ +  N
Sbjct: 184 GEAKTETWLRGVKEN 198


>gi|150395553|ref|YP_001326020.1| extracellular solute-binding protein [Sinorhizobium medicae WSM419]
 gi|150027068|gb|ABR59185.1| extracellular solute-binding protein family 1 [Sinorhizobium
           medicae WSM419]
          Length = 346

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 78/192 (40%), Gaps = 10/192 (5%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--- 59
            + +   L +   F    +  +    + +Y+ +   ++ P++ +F + TG+  + ++   
Sbjct: 4   SKALIGALSVATAF-LGSTAAHAEGEVNIYSYRQPELIQPLLDAFTKETGITTNVLFLDK 62

Query: 60  TSSIQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       SP DVI+T D + L  A +  +   +    I K      ++ +     
Sbjct: 63  GLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPVVNETINKDIPEHFRDPDGNWFG 122

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           ++   +V+  S +R+   ++  +  DL + +WK ++       S++  L  +M     + 
Sbjct: 123 LTTRGRVVYASKERVAQDEI--TYEDLADPKWKGKICTRDGQHSYNVGLFASMIAHHGEA 180

Query: 176 VVQDFIKNITAN 187
             + ++  +  N
Sbjct: 181 ETEKWLAGLRDN 192


>gi|109897917|ref|YP_661172.1| extracellular solute-binding protein [Pseudoalteromonas atlantica
           T6c]
 gi|109700198|gb|ABG40118.1| extracellular solute-binding protein, family 1 [Pseudoalteromonas
           atlantica T6c]
          Length = 351

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/199 (18%), Positives = 82/199 (41%), Gaps = 12/199 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            KR +    L+ C    A +     + L +Y+ + ++++ P++  F   +G+ ++ +   
Sbjct: 14  LKRFLKLVGLVSCISMSALA---EAQELNVYSARKEALIKPLLDKFSASSGISVNLVTGK 70

Query: 62  SIQRP--PITQG--SPVDVIITKDETSL--ALNEDLLHKLP-AHLIKKNSFVLKNENKKL 114
           +        ++G  SP D++IT D   L  A  + L   +         S    + +   
Sbjct: 71  ADALITRLKSEGKYSPADILITTDVGRLHRAKEQGLTQAIQTDEFKDLISPNYIDPDNNW 130

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
           +  +   + +  + +R+ IA L   + DL + QW+ R+ + + +NI    L+  M     
Sbjct: 131 IGFTLRARPMMVAPERVDIAQL-TRIEDLADEQWRGRICVRSSSNIYNQSLVAAMIAQLG 189

Query: 174 KTVVQDFIKNITANEILTK 192
           +   Q ++     N   T 
Sbjct: 190 EEQTQSWLNAFVKNFARTP 208


>gi|209696004|ref|YP_002263934.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Aliivibrio salmonicida LFI1238]
 gi|208009957|emb|CAQ80272.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Aliivibrio salmonicida LFI1238]
          Length = 337

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
            K+ +    L+   F     +    + + +Y+ +   ++ P+   F + TG+K++  +  
Sbjct: 1   MKKLLSVSALIAGVFAP---SVMAAEEVNVYSYRQPFLVEPMFKEFTKETGIKVNVKFAK 57

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DVI+T D + LA   N+ L+  + +  I        ++ + +  
Sbjct: 58  KGLAEKLAQEGELSPADVILTTDISRLAELTNKKLVQPVDSKTIDANVPAQYRDADDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNK 174
            ++   + +  S  R+          DL N +WK ++        ++  L+++M     +
Sbjct: 118 ALTLRARNVYSSRDRVGKLGADFDYADLANPEWKGKICTRSGKHPYNVSLVSSMIAHHGE 177

Query: 175 TVVQDFIKNITAN 187
              + +++ + AN
Sbjct: 178 AEAKTWLEGLKAN 190


>gi|297582847|ref|YP_003698627.1| family 1 extracellular solute-binding protein [Bacillus
           selenitireducens MLS10]
 gi|297141304|gb|ADH98061.1| extracellular solute-binding protein family 1 [Bacillus
           selenitireducens MLS10]
          Length = 358

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 75/200 (37%), Gaps = 17/200 (8%)

Query: 6   IYTYLLLLCGFTEAFSTE----------NTTKYLTLYTDQNQSVMLPIIHSFEERTGVKI 55
           +  ++L  CG      T                L +Y+ +N++ +  ++  FEE TG+++
Sbjct: 12  LPGFMLAACGNDGNNETGSNEANDNEVVEAGGELVVYSARNETFVQALLDKFEEDTGIEV 71

Query: 56  SPIYTSS-IQRPPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIKKNSFVLKNENK 112
             ++ +  +Q          D+ I+ D   L     +DLL       +       + EN 
Sbjct: 72  LALHGAEPLQIQEEAGNVQADIFISNDLGGLEYLNQQDLLEGGDYENVDSIDEQYRAENN 131

Query: 113 KLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKK-RLSIAPN---NISFHRLLNTM 168
           + + +S   +   Y+   I   D+P+S+ DL +  +       A     N      ++ +
Sbjct: 132 EWIALSSRARGFIYNKDMIAEEDVPQSMEDLFDPSYADVENGYAITRGGNGGMIGNVSAL 191

Query: 169 EQTPNKTVVQDFIKNITANE 188
                    Q++I+ I  N 
Sbjct: 192 RYEWGDERTQEWIETIQENA 211


>gi|22298056|ref|NP_681303.1| iron binding protein component of ABC iron transporter
           [Thermosynechococcus elongatus BP-1]
 gi|81743704|sp|Q8DLH9|IDIA_THEEB RecName: Full=Iron deficiency-induced protein A; Flags: Precursor
 gi|22294234|dbj|BAC08065.1| iron binding protein component of ABC iron transporter
           [Thermosynechococcus elongatus BP-1]
          Length = 355

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 81/178 (45%), Gaps = 9/178 (5%)

Query: 18  EAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP--PITQGS--P 73
            +++ +++   + +Y+ ++      + ++F ++TG++++ I   +        ++GS  P
Sbjct: 31  SSYAQQSSGGVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRTP 90

Query: 74  VDVIITKDETSL--ALNEDLLHKLPAHLIKKN-SFVLKNENKKLMRISFDTQVLAYSTKR 130
            DV+IT D   L  A    +L  + + ++       L+        +S   +VL Y+  R
Sbjct: 91  ADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSRRVRVLIYNKSR 150

Query: 131 IKIADLPKSVFDLTNAQWKKRL-SIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           +  + L  +  DL N +W++++ + + +NI    L  ++         + + + +  N
Sbjct: 151 VNPSQL-STYEDLANPKWRRQILTRSSSNIYNQSLTGSLLAIHGAQKTEQWARGLVQN 207


>gi|226946737|ref|YP_002801810.1| iron ABC transporter periplasmic iron-binding protein [Azotobacter
           vinelandii DJ]
 gi|226721664|gb|ACO80835.1| iron ABC transporter, periplasmic iron-binding protein [Azotobacter
           vinelandii DJ]
          Length = 334

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 76/186 (40%), Gaps = 9/186 (4%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQR 65
           L +L     + +       + +Y+ +   ++ P+  ++   TGVK+  I         + 
Sbjct: 8   LAVLVLGALSGAALAADDEIVVYSSRIDELIKPVFDAYTAETGVKVKFITDKEAPLIARL 67

Query: 66  PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
               + +P D++IT D  +L  A  E +L  + + ++K       ++       +S   +
Sbjct: 68  KAEGKNTPADLLITVDAGNLWQAEQEGVLRPIDSPVVKANIPPQYRSATGAWSGLSLRAR 127

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFI 181
            + YST+R++  +L  +   L +  W+ RL +  +   +   L  T+ +       +  +
Sbjct: 128 TIFYSTERVRPEEL-STYEALADENWEGRLCLRTSKKVYNQSLTATLIEAHGAEKAEQIV 186

Query: 182 KNITAN 187
           +    N
Sbjct: 187 RGWVNN 192


>gi|152983951|ref|YP_001351278.1| putative iron ABC transporter binding protein subunit [Pseudomonas
           aeruginosa PA7]
 gi|150959109|gb|ABR81134.1| probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PA7]
          Length = 332

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGSPVDVII 78
                 + +Y+ +   ++ P+  ++  +TGVK+  I                 +P D+++
Sbjct: 19  AQAADEVVVYSSRIDELIKPVFDAYTSKTGVKVRFITDKEAPLMARIKAEGANTPADLLL 78

Query: 79  TKDETSLALNE--DLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L   E   LL    +  I+       ++       +S   + + YST+R+K  +
Sbjct: 79  TVDAGNLWQAEQMGLLQPFKSATIEGNIPPQYRSSTDSWTGLSLRARTIVYSTERVKPEE 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L + QW+ RL +      +   L  T+ +T      ++ ++    N
Sbjct: 139 L-STYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNN 190


>gi|330812482|ref|YP_004356944.1| iron (III) ABC transporter periplasmic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380590|gb|AEA71940.1| putative iron (III) ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 334

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 76/193 (39%), Gaps = 13/193 (6%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           KR +    L L G T A         + +Y+ +   ++ P+  ++  +TGV +  I    
Sbjct: 5   KRLLSALALTLIGTTAA----QAADEVVVYSSRIDELIKPVFDAYTRKTGVSVKFITDKE 60

Query: 63  IQRP----PITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLM 115
                      + +  D+++T D  +L   E   +L    + +I        +  +    
Sbjct: 61  APLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSPVIDANIPSQYRASSHAWT 120

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNK 174
            +S   + + YST R+K ++L  +   L   +W+ RL +  +   +   L  T+ +T   
Sbjct: 121 GLSLRARTIVYSTDRVKPSEL-STYEALAGDEWEGRLCLRTSKKVYNQSLTATLIETHGA 179

Query: 175 TVVQDFIKNITAN 187
              ++ +K    N
Sbjct: 180 EKTEEILKGWVRN 192


>gi|148550303|ref|YP_001270405.1| extracellular solute-binding protein [Pseudomonas putida F1]
 gi|148514361|gb|ABQ81221.1| extracellular solute-binding protein, family 1 [Pseudomonas putida
           F1]
          Length = 333

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++  +TGVKI  I                    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGDNGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I +      +  +     +S   + + YST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIESDVIDQNIPSQYRASSHDWTGLSLRARTIIYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L + QW+ RL +      +   L  T+ +T  +   +  +K    N
Sbjct: 137 PEEL-STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQIVKGWVNN 191


>gi|227820924|ref|YP_002824894.1| extracelluar solute-binding protein, family 1 [Sinorhizobium fredii
           NGR234]
 gi|227339923|gb|ACP24141.1| extracelluar solute-binding protein, family 1 [Sinorhizobium fredii
           NGR234]
          Length = 347

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 75/192 (39%), Gaps = 9/192 (4%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--- 59
            +T+   L +        +       + +Y+ +   ++ P++ +F + TG+  + ++   
Sbjct: 4   SKTLIGTLSVAAAILAFSAPARAEGEVNIYSYRQPDLIKPLLDAFTKETGIAANVLFLDK 63

Query: 60  TSSIQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       SP DVI+T D + L  A +  +   L    I K      ++ +     
Sbjct: 64  GLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPLVNETINKDIPAHFRDPDGNWFG 123

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           ++   +V+  S +R+   D+  +  +L + +WK +        S++  L  +M     + 
Sbjct: 124 LTTRGRVVYASKERVPQNDI--TYEELADPKWKGKFCTRDGQHSYNIGLFASMIAHHGEA 181

Query: 176 VVQDFIKNITAN 187
             + ++     N
Sbjct: 182 ETEKWLTGFRDN 193


>gi|56751929|ref|YP_172630.1| iron(III) transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81300984|ref|YP_401192.1| transport system substrate-binding protein [Synechococcus elongatus
           PCC 7942]
 gi|56686888|dbj|BAD80110.1| iron(III) transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81169865|gb|ABB58205.1| transport system substrate-binding protein [Synechococcus elongatus
           PCC 7942]
          Length = 366

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 77/199 (38%), Gaps = 12/199 (6%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +   LLL          E     + LY+ ++ +    I   F ++TG+K++ I   +  
Sbjct: 26  ALAGTLLLDSFGDWRRRAEAAEGEVNLYSGRHYNTDNQIYREFTQKTGIKVNLIEGEADA 85

Query: 65  RPPIT--QGS--PVDVIITKDETSL--ALNEDLLHKL----PAHLIKKNSFVLKNENKKL 114
                  +GS  P DV IT D   L  A   +LL  L       L +     L++   + 
Sbjct: 86  LLARLKSEGSRSPADVFITVDAGRLWQATQANLLRPLTQAQAPKLYQAVPANLRDPQGRW 145

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             +S   +V+ Y+  R+  + L  +  DL N +W+ ++ + + +N+    L   M     
Sbjct: 146 FALSKRARVIMYNRDRVNASQL-STYEDLANPKWRNQILVRSSSNVYNLSLTGEMIAADG 204

Query: 174 KTVVQDFIKNITANEILTK 192
               + + + +  N     
Sbjct: 205 AAKTEAWARGLVQNFARQP 223


>gi|332524214|ref|ZP_08400440.1| ABC transporter iron binding protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332107549|gb|EGJ08773.1| ABC transporter iron binding protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 341

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 76/169 (44%), Gaps = 9/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSIQRPPITQG--SPVDVIITKDE 82
           + +T+Y+ + + ++ P +  + + TGV+I+ +     S+      +G  SP DV+IT D 
Sbjct: 28  QPVTVYSSRIEQLLKPTLDRYTQETGVRINLLTDRGGSLTERLAAEGASSPADVLITVDM 87

Query: 83  TSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L  A    LL KL +  +        ++   +   +S   + + Y+  +++ A L  +
Sbjct: 88  GNLWNAAERGLLRKLQSPTLDANVPASFRDPGSRWWGLSQRERTIFYAAGKVQPAQL-ST 146

Query: 140 VFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL   +WK +L +     ++   L+  M     +   ++  +   AN
Sbjct: 147 YEDLALPKWKGKLCLRTGKQTYTQSLVAMMIAKHGEARAEEIARGWVAN 195


>gi|2125893|emb|CAA88640.1| idiA [Synechococcus elongatus PCC 6301]
          Length = 366

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 77/199 (38%), Gaps = 12/199 (6%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +   LLL          E     + LY+ ++ +    I   F ++TG+K++ I   +  
Sbjct: 26  ALAGTLLLDSFGDWRRRAEAAEGEVNLYSGRHYNTDNQIYREFTQKTGIKVNLIEGEATA 85

Query: 65  RPPIT--QGS--PVDVIITKDETSL--ALNEDLLHKL----PAHLIKKNSFVLKNENKKL 114
                  +GS  P DV IT D   L  A   +LL  L       L +     L++   + 
Sbjct: 86  LLARLKSEGSRSPADVFITVDAGRLWQATQANLLRPLTQAQAPKLYQAVPANLRDPQGRW 145

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             +S   +V+ Y+  R+  + L  +  DL N +W+ ++ + + +N+    L   M     
Sbjct: 146 FALSKRARVIMYNRDRVNASQL-STYEDLANPKWRNQILVRSSSNVYNLSLTGEMIAADG 204

Query: 174 KTVVQDFIKNITANEILTK 192
               + + + +  N     
Sbjct: 205 AAKTEAWARGLVQNFARQP 223


>gi|218894319|ref|YP_002443189.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa LESB58]
 gi|218774548|emb|CAW30365.1| probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa LESB58]
          Length = 332

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVII 78
                 + +Y+ +   ++ P+  ++  +TGVK+  I                 +P D+++
Sbjct: 19  AQAADEVVVYSSRIDELIKPVFDAYTSKTGVKVKFITDKEAPLMARIKAEGANTPADLLL 78

Query: 79  TKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L   E   LL    +  I++      ++       +S   + + YST+R+K  +
Sbjct: 79  TVDAGNLWQAEQMGLLQPFKSATIERNIPSQYRSSTDSWTGLSLRARTIVYSTERVKPEE 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L + QW+ RL +      +   L  T+ +T      ++ ++    N
Sbjct: 139 L-STYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNN 190


>gi|15600410|ref|NP_253904.1| binding protein component of ABC iron transporter [Pseudomonas
           aeruginosa PAO1]
 gi|107104319|ref|ZP_01368237.1| hypothetical protein PaerPA_01005393 [Pseudomonas aeruginosa PACS2]
 gi|116053365|ref|YP_793689.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254238086|ref|ZP_04931409.1| hypothetical protein PACG_04202 [Pseudomonas aeruginosa C3719]
 gi|254243901|ref|ZP_04937223.1| hypothetical protein PA2G_04730 [Pseudomonas aeruginosa 2192]
 gi|296392074|ref|ZP_06881549.1| putative binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PAb1]
 gi|313110287|ref|ZP_07796179.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa 39016]
 gi|76363283|sp|Q9HTX3|P5217_PSEAE RecName: Full=Probable binding protein component of ABC iron
           transporter PA5217; Flags: Precursor
 gi|9951524|gb|AAG08602.1|AE004934_9 probable binding protein component of ABC iron transporter
           [Pseudomonas aeruginosa PAO1]
 gi|115588586|gb|ABJ14601.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170017|gb|EAZ55528.1| hypothetical protein PACG_04202 [Pseudomonas aeruginosa C3719]
 gi|126197279|gb|EAZ61342.1| hypothetical protein PA2G_04730 [Pseudomonas aeruginosa 2192]
 gi|310882681|gb|EFQ41275.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas aeruginosa 39016]
          Length = 332

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query: 23  ENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVII 78
                 + +Y+ +   ++ P+  ++  +TGVK+  I                 +P D+++
Sbjct: 19  AQAADEVVVYSSRIDELIKPVFDAYTSKTGVKVKFITDKEAPLMARIKAEGANTPADLLL 78

Query: 79  TKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIAD 135
           T D  +L   E   LL    +  I++      ++       +S   + + YST+R+K  +
Sbjct: 79  TVDAGNLWQAEQMGLLQPFKSATIERNIPSQYRSSTDSWTGLSLRARTIVYSTERVKPEE 138

Query: 136 LPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           L  +   L + QW+ RL +      +   L  T+ +T      ++ ++    N
Sbjct: 139 L-STYEALADKQWEGRLCLRTAKKVYNQSLTGTLIETHGAQKTEEILQGWVNN 190


>gi|89074138|ref|ZP_01160637.1| putative ABC transporter, periplasmic iron-compound-binding protein
           [Photobacterium sp. SKA34]
 gi|89050074|gb|EAR55600.1| putative ABC transporter, periplasmic iron-compound-binding protein
           [Photobacterium sp. SKA34]
          Length = 337

 Score =  144 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 85/195 (43%), Gaps = 14/195 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+ + + +L+      A       + + +Y+ +   ++ P+ + F + TG+K++  +  
Sbjct: 1   MKKLLASAILMGLA---APQVATAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAK 57

Query: 62  -SIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIK-KNSFVLKNENKKLM 115
             +      +G  SP DV++T D + L    ++ L+  + + LI        ++   +  
Sbjct: 58  KGLAEKLEQEGEYSPADVVLTTDISRLVELSDKKLVQPVDSKLIDGNVPAQFRDNEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++  ++ +  S  R+    LP S    DL   +WK ++        ++  L+++M    
Sbjct: 118 ALTLRSRNVYSSKDRV--GKLPASFDYADLAKPEWKGKICTRSGKHPYNVSLVSSMIAHY 175

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ + AN
Sbjct: 176 GEAETKKWLEGVKAN 190


>gi|83950453|ref|ZP_00959186.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius nubinhibens ISM]
 gi|83838352|gb|EAP77648.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius nubinhibens ISM]
          Length = 318

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/170 (19%), Positives = 71/170 (41%), Gaps = 10/170 (5%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----PPITQGSPVDVIITKD 81
              + +Y+ ++      +   F E+TG+ ++ I   + +           SP DV IT D
Sbjct: 2   ADEVNVYSSRHYDSDDALYAKFTEQTGITVNRIEGEADELIARLSAEGDNSPADVFITVD 61

Query: 82  ETSLALNE--DLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK 138
              +   E   +L  + + +I       L++       +S   +++ Y+  R+   + P+
Sbjct: 62  IGRMGRAEEAGVLQAVESDVIANAVPKHLRDPENMWFGVSQRARIIFYAKDRV--ENPPR 119

Query: 139 SVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           S  +L +   K ++ I  + NI    LL ++ +   +   +D+   I AN
Sbjct: 120 SYEELADPSLKGQICIRSSKNIYNQSLLASLIEANGEEAAKDWAAGIVAN 169


>gi|167036243|ref|YP_001671474.1| extracellular solute-binding protein [Pseudomonas putida GB-1]
 gi|166862731|gb|ABZ01139.1| extracellular solute-binding protein family 1 [Pseudomonas putida
           GB-1]
          Length = 333

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++  +TGVKI  I                    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGDNGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I +      +  +     +S   + + YST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIKSDIIDQNIPPQYRASSHDWTGLSLRARTIIYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L + QW+ RL +      +   L  T+ +T  +   +  +K    N
Sbjct: 137 PEEL-STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEQVVKGWVNN 191


>gi|261345718|ref|ZP_05973362.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Providencia rustigianii DSM 4541]
 gi|282566206|gb|EFB71741.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Providencia rustigianii DSM 4541]
          Length = 348

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 85/193 (44%), Gaps = 21/193 (10%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSS 62
           T+ + L++ C              LTLYT +   ++ P++ +F + T + ++ +Y     
Sbjct: 16  TLASSLIVTCALPAMAKD-----SLTLYTTREPGLIQPLLDAFTKETAIDVNTVYIKDGM 70

Query: 63  IQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMRIS 118
           ++R     + SP D+++T D  +L   ++  +   + + ++ +     L++++ +   +S
Sbjct: 71  LERVKAEGKNSPADLLMTVDAGNLIDLVDAGVTQPVQSEVLTEVIPASLRDKDNQWFGLS 130

Query: 119 FDTQVLAYSTKRIKIADLPKS---VFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNK 174
              +VL           +P S     +L + QWK ++ I A  +     L+  M     +
Sbjct: 131 MRARVL------YAEKSMPLSSITYENLADPQWKGKICIRAGQHPYNTALVAAMIAHDGE 184

Query: 175 TVVQDFIKNITAN 187
              + +++++  N
Sbjct: 185 AKTEAWLRDVKNN 197


>gi|92112682|ref|YP_572610.1| extracellular solute-binding protein [Chromohalobacter salexigens
           DSM 3043]
 gi|91795772|gb|ABE57911.1| extracellular solute-binding protein, family 1 [Chromohalobacter
           salexigens DSM 3043]
          Length = 341

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 73/179 (40%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGS 72
              F+ +   + + +Y+ ++      +  +F E+TG+ ++ +   S Q           S
Sbjct: 16  GAIFAGDALAEEVNIYSARHYDSDQALYDAFTEKTGIDVNILEGDSDQLIERIRREGAAS 75

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTK 129
           P D+++T D   L  A    +   + + ++ ++    +++   K    S   + + Y   
Sbjct: 76  PADIMLTVDAGRLWRAEQAGVFQGIESDVLNERLPDAMRHPEGKWFGFSQRVRAIFYDPD 135

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            +  A+L K   DL + +++  + I  + NI    LL +M         + + + +  N
Sbjct: 136 DVDPANL-KRYEDLADPRFEGDICIRSSNNIYNQSLLASMIAHHGMDDAEAWAQGVVDN 193


>gi|76803129|ref|YP_331224.1| iron(III ABC transporter periplasmic substrate-binding protein ABC
           transporter periplasmic substrate-binding protein 1
           [Natronomonas pharaonis DSM 2160]
 gi|76558994|emb|CAI50591.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate iron(III)) 1 [Natronomonas pharaonis
           DSM 2160]
          Length = 410

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 71/177 (40%), Gaps = 14/177 (7%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEER-TGVKISPIYTSS----IQRPPITQGSPVDVIITK 80
              +T+Y+ +    +  +    E   +G+ I+  Y  +     Q     + +P DV  ++
Sbjct: 90  EGEITVYSGRTPDQIDLVFEQLENEYSGLTINRDYDDNDAQVNQLMQEGEATPADVFYSQ 149

Query: 81  DETSL--ALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI----- 133
           D  +L    +  L   LP  +I       ++ +     +S   + + Y++ R+       
Sbjct: 150 DPGALQAVADNGLTQVLPEDVIDTVPGSYRHPDGHWTGVSGRVRSVLYNSDRLDETPFDS 209

Query: 134 -ADLPKSVFDLT-NAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANE 188
             +LP  +F    + +++  ++  PN+ +F   + +M +   +   + ++ +    +
Sbjct: 210 WDELPDDIFSYAEDPRFEGIIATRPNSGTFRGFIQSMVELEGEETTRQWVSDFMDQD 266


>gi|330501302|ref|YP_004378171.1| putative binding protein component of ABC iron transporter
           [Pseudomonas mendocina NK-01]
 gi|328915588|gb|AEB56419.1| putative binding protein component of ABC iron transporter
           [Pseudomonas mendocina NK-01]
          Length = 333

 Score =  144 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 75/187 (40%), Gaps = 9/187 (4%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQ 64
            LL     +   +       + +Y+ +   ++ P+  ++  +TGVK+  I         +
Sbjct: 6   ALLAAFTLSTLATAVQAADEVVVYSSRIDELIKPVFDAYTAKTGVKVKFITDKEAPLIAR 65

Query: 65  RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDT 121
                  +P D++IT D  +L  A  E +L    + +I        ++       +S   
Sbjct: 66  LKAEGANTPADMLITVDAGNLWQAEQEGVLQPTKSDVIDANIPAQYRSSTDSWTGLSLRA 125

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDF 180
           + + YST+R+K  +L  +   L +  W+ RL +  +   +   L  T+ +T      ++ 
Sbjct: 126 RTIFYSTERVKPEEL-STYEALADKNWEGRLCLRTSKKVYNQSLTATLIETHGAEKTEEI 184

Query: 181 IKNITAN 187
           +K    N
Sbjct: 185 VKGWVNN 191


>gi|90580256|ref|ZP_01236063.1| putative ABC transporter, periplasmic iron-compound-binding protein
           [Vibrio angustum S14]
 gi|90438558|gb|EAS63742.1| putative ABC transporter, periplasmic iron-compound-binding protein
           [Vibrio angustum S14]
          Length = 337

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 85/195 (43%), Gaps = 14/195 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+ + + +L+      A       + + +Y+ +   ++ P+ + F + TG+K++  +  
Sbjct: 1   MKKLLASAILMGLA---APQVATAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAK 57

Query: 62  -SIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIK-KNSFVLKNENKKLM 115
             +      +G  SP DV++T D + L    ++ L+  + + LI        ++   +  
Sbjct: 58  KGLAEKLEQEGEYSPADVVLTTDISRLVELSDKKLVQPVDSKLIDGNVPAQFRDNEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++  ++ +  S  R+    LP S    DL   +WK ++        ++  L+++M    
Sbjct: 118 ALTLRSRNVYSSKDRV--GKLPASFDYADLAKPEWKGKICTRSGKHPYNVSLVSSMIAHY 175

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ + AN
Sbjct: 176 GEAETKKWLEGVKAN 190


>gi|77918503|ref|YP_356318.1| ABC transporter periplasmic protein [Pelobacter carbinolicus DSM
           2380]
 gi|77544586|gb|ABA88148.1| ABC-type transport system, periplasmic component [Pelobacter
           carbinolicus DSM 2380]
          Length = 326

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 85/189 (44%), Gaps = 16/189 (8%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS----IQR 65
           +  +CG +++ +       L +Y+ +N+ ++ P+  ++ E+TG +I  I   +     + 
Sbjct: 1   MAAICGVSQSLAEAG---ELVVYSARNEHLIQPLFDAYTEQTGTEIRFITDKAGPLLARL 57

Query: 66  PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
                G+P D++IT D  +L  A  E +L  + +  +++     L++   +   +S   +
Sbjct: 58  KAEGSGTPADLLITVDAGNLWHAAQEGILQPVVSETLQRNIPEHLRDTENRWFGLSLRAR 117

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVV---- 177
            L YST+R++   L  +   L    WK RL +  +   +   L+  +     +       
Sbjct: 118 TLVYSTERVRPEQL-STYAALGGEVWKGRLLLRTSKKVYNQSLVAMLIAAHGEAGAESIV 176

Query: 178 QDFIKNITA 186
           + ++ N+ A
Sbjct: 177 RSWVDNLAA 185


>gi|227113188|ref|ZP_03826844.1| ABC transporter, substrate binding protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 349

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 81/192 (42%), Gaps = 10/192 (5%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI--YT 60
           K+     L        A         LTLYT +   ++ P++ +F + T VK++ +    
Sbjct: 10  KKARLLTLASSLMVAYALPAVAADDSLTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKD 69

Query: 61  SSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKL-PAHLIKKNSFVLKNENKKLMR 116
             ++R     Q SP D+++T D  +L   +   +   +  + L +     L++++ +   
Sbjct: 70  GMLERVKAEGQNSPADLLMTVDAGNLIDLVEAGVTQPIQSSALTEAIPAALRDKDNQWFG 129

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKT 175
           +S   +VL Y+ K + +        DL + +WK ++ + A  +     ++  M     + 
Sbjct: 130 LSMRARVL-YAEKGLAVDSF--HYEDLADPKWKGKVCLRAGQHPYNTAMIAAMIAHHGEA 186

Query: 176 VVQDFIKNITAN 187
             + +++ +  N
Sbjct: 187 KTETWLRGVKDN 198


>gi|313501173|gb|ADR62539.1| Iron ABC transporter, periplasmic iron-binding protein, putative
           [Pseudomonas putida BIRD-1]
          Length = 333

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 71/176 (40%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++  +TGVKI  I                    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGDNGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I +      +  + +   +S   + + YST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIESDVIDQNIPAQYRASSHEWTGLSLRARTIIYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L + QW+ RL +      +   L  T+ +T  +   +  +K    N
Sbjct: 137 PEEL-STYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGEAKTEKIVKGWVNN 191


>gi|296274170|ref|YP_003656801.1| family 1 extracellular solute-binding protein [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098344|gb|ADG94294.1| extracellular solute-binding protein family 1 [Arcobacter
           nitrofigilis DSM 7299]
          Length = 335

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 76/175 (43%), Gaps = 9/175 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVDV 76
           S+   +  + +Y+ ++      I   FE+ TG+K++ +   + +     +     SP DV
Sbjct: 14  SSLYASNEVNVYSHRHYDTDKKIFKLFEKETGIKVNVVKAMADELIKRMETEGDKSPADV 73

Query: 77  IITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           +IT D   L  A  + LL  + +  ++K     L++++ +   ++   +V  Y       
Sbjct: 74  LITVDAAGLYKAKTKGLLQAIKSDYLEKNIPKNLRDKDNEWFGVTIRARVAVYKKGEGIG 133

Query: 134 ADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            +L  +  DL + ++K ++ +  +N  +   LL  +     K     + K I AN
Sbjct: 134 KEL-STYEDLADPKYKGQIMVRSSNNVYNQSLLAAVVAHHGKEYALKWAKGIVAN 187


>gi|15964482|ref|NP_384835.1| putative iron binding protein [Sinorhizobium meliloti 1021]
 gi|307308425|ref|ZP_07588129.1| extracellular solute-binding protein family 1 [Sinorhizobium
           meliloti BL225C]
 gi|307318988|ref|ZP_07598419.1| extracellular solute-binding protein family 1 [Sinorhizobium
           meliloti AK83]
 gi|15073659|emb|CAC45301.1| Fe3+ ABC transporter [Sinorhizobium meliloti 1021]
 gi|306895402|gb|EFN26157.1| extracellular solute-binding protein family 1 [Sinorhizobium
           meliloti AK83]
 gi|306901028|gb|EFN31636.1| extracellular solute-binding protein family 1 [Sinorhizobium
           meliloti BL225C]
          Length = 347

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 79/192 (41%), Gaps = 9/192 (4%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--- 59
            + +   L +   F  + +       + +Y+ +   ++ P++ +F ++TG+  + ++   
Sbjct: 4   SKALIGALSVAATFLASTAPVRADGEVNIYSYRQPDLIQPLLDAFTKKTGITTNVLFLDK 63

Query: 60  TSSIQRPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       SP DVI+T D + L  A +  +   +    I K      ++ +     
Sbjct: 64  GLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPVANETINKDIPDHFRDPDGNWFG 123

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           ++   +V+  S +R+   D+  +  +L + +WK ++       S++  L  +M     + 
Sbjct: 124 LTTRGRVVYASKERVAQDDI--TYEELADPKWKGKICTRDGQHSYNVGLFASMIAHHGEA 181

Query: 176 VVQDFIKNITAN 187
             + ++  +  N
Sbjct: 182 EAEKWLTGLRNN 193


>gi|260913793|ref|ZP_05920268.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Pasteurella dagmatis ATCC 43325]
 gi|260632106|gb|EEX50282.1| iron ABC superfamily ATP binding cassette transporter, binding
           protein [Pasteurella dagmatis ATCC 43325]
          Length = 337

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 84/196 (42%), Gaps = 15/196 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M K +     L     T A +       + +Y+ +   ++ P++  FE+ TG+K++ I+ 
Sbjct: 1   MKKISTLALALSAVISTSALAAN----EVNVYSYRQPYLIEPMLKDFEKDTGIKVNVIFA 56

Query: 61  SS---IQRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKL 114
                 +     + SP DV++T D + +   +   L   + + +++K      ++   + 
Sbjct: 57  DKGLVDRVKREGELSPADVLLTVDISRVMELVKSGLAQPIHSEVLEKNIPAQFRDSKDEW 116

Query: 115 MRISFDTQVLAYSTKRIKIADLPK--SVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQT 171
             ++   +V+  S  R+    LP   S +DL   ++K ++ +    N     L+ ++   
Sbjct: 117 FALTSRARVIYTSKDRV--GKLPADFSYYDLAKPEYKGKVCVRSGKNAYNVSLVASIIAH 174

Query: 172 PNKTVVQDFIKNITAN 187
             +   ++F+  + AN
Sbjct: 175 DGEEKAKEFLTGLKAN 190


>gi|218671223|ref|ZP_03520894.1| iron(III) ABC transporter, substrate-binding protein [Rhizobium
           etli GR56]
          Length = 204

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 99  LIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNN 158
            + +     +  +     I+  T V AY   ++    LPKS+ DL +  WK R   AP  
Sbjct: 1   TLDQVPDQYRPTDGMWTGIAARTTVFAYDKTKLTEDKLPKSMLDLADPAWKGRWGAAPAG 60

Query: 159 ISFHRLLNTMEQTPNKTVVQDFIKNITANEILTKYK 194
             F  ++  + Q   +   + ++K +  N   T YK
Sbjct: 61  ADFQAIVAALLQLKGEDATKAWLKGLKDN--ATPYK 94


>gi|149915720|ref|ZP_01904245.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. AzwK-3b]
 gi|149810302|gb|EDM70147.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. AzwK-3b]
          Length = 340

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 75/185 (40%), Gaps = 10/185 (5%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----P 66
           L+      A +     + + +Y+ ++      +   F  RTG+ ++ I   + +      
Sbjct: 9   LIAAIALSATALPALAQEVNVYSSRHYDTDDALYQEFTNRTGITVNRIEAKADELIARMQ 68

Query: 67  PITQGSPVDVIITKDET--SLALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQV 123
                SP DV +T D    S A    +L    + +I  +    L++       +S   ++
Sbjct: 69  AEGDNSPADVFLTVDVGRASRAEEAGVLQAFSSDVIDERIPPHLRDPENMWFGVSQRARI 128

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIK 182
           + Y+  R+   + P++  +L + +WK  + I + +NI    LL  +     +   +D+  
Sbjct: 129 IFYAKDRV--ENPPRTYEELADPKWKDTICIRSGSNIYNLSLLAGLIDVHGEEAARDWAS 186

Query: 183 NITAN 187
            + AN
Sbjct: 187 GVLAN 191


>gi|253687739|ref|YP_003016929.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754317|gb|ACT12393.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 349

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 81/195 (41%), Gaps = 16/195 (8%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--T 60
           K+     L        A         LTLYT +   ++ P++ +F + T VK++ ++   
Sbjct: 10  KKARLLTLASSLMVAYALPAAAADDSLTLYTTREPGLIQPLLDAFTKETSVKVNTVFIKD 69

Query: 61  SSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKKN-SFVLKNENKKLMR 116
             ++R     Q SP D+++T D  +L   +   +   + +  + +     L++++ +   
Sbjct: 70  GMLERVKAEGQNSPADLLMTVDAGNLIDLVEAGVTQPIQSSTLTEVIPAALRDKDNQWFG 129

Query: 117 ISFDTQVLAYSTKRIKIADLP---KSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTP 172
           +S  ++VL           LP    +  +L + +WK ++ I A  +     L+  M    
Sbjct: 130 LSMRSRVL------YAEKSLPLTGITYENLADPKWKGKVCIRAGQHPYNTALVAAMIAHH 183

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ +  N
Sbjct: 184 GEAKTETWLRGVKDN 198


>gi|237809299|ref|YP_002893739.1| extracellular solute-binding protein family 1 [Tolumonas auensis
           DSM 9187]
 gi|237501560|gb|ACQ94153.1| extracellular solute-binding protein family 1 [Tolumonas auensis
           DSM 9187]
          Length = 332

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 88/190 (46%), Gaps = 16/190 (8%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQ 64
           +    LL+ G  +A       + + +Y+ +   ++ PI+ +FE+  G+K++ +Y    + 
Sbjct: 4   VALLALLVAGSVQA------AEEINVYSARQAYLIEPIVQAFEKEQGIKVNLVYAEDGLA 57

Query: 65  RPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISF 119
                +G  +P D+++T D + L   + +DL+  + +  +        ++ + +   ++ 
Sbjct: 58  ERLAREGKHTPADLVLTVDISRLMELVEQDLVQPVNSQTLNSNIPAQYRDPDNRWFALTT 117

Query: 120 DTQVLAYSTKRI-KIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVV 177
             + +  S +R+ K  D+  +   L + ++K ++       S++  L+ +M     +   
Sbjct: 118 RVRNIYTSKERVGKPDDI--TYESLADEKYKGKICTRSGKNSYNVALVASMIAHHGEAKA 175

Query: 178 QDFIKNITAN 187
           + +++ + AN
Sbjct: 176 EQWLEGLKAN 185


>gi|205830864|sp|Q5N0R0|IDIA_SYNP6 RecName: Full=Iron deficiency-induced protein A; Flags: Precursor
 gi|205830865|sp|Q31L64|IDIA_SYNE7 RecName: Full=Iron deficiency-induced protein A; Flags: Precursor
 gi|14331111|emb|CAC40996.1| iron deficiency induced protein A [Synechococcus elongatus PCC
           7942]
          Length = 357

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 77/199 (38%), Gaps = 12/199 (6%)

Query: 5   TIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
            +   LLL          E     + LY+ ++ +    I   F ++TG+K++ I   +  
Sbjct: 17  ALAGTLLLDSFGDWRRRAEAAEGEVNLYSGRHYNTDNQIYREFTQKTGIKVNLIEGEADA 76

Query: 65  RPPIT--QGS--PVDVIITKDETSL--ALNEDLLHKL----PAHLIKKNSFVLKNENKKL 114
                  +GS  P DV IT D   L  A   +LL  L       L +     L++   + 
Sbjct: 77  LLARLKSEGSRSPADVFITVDAGRLWQATQANLLRPLTQAQAPKLYQAVPANLRDPQGRW 136

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             +S   +V+ Y+  R+  + L  +  DL N +W+ ++ + + +N+    L   M     
Sbjct: 137 FALSKRARVIMYNRDRVNASQL-STYEDLANPKWRNQILVRSSSNVYNLSLTGEMIAADG 195

Query: 174 KTVVQDFIKNITANEILTK 192
               + + + +  N     
Sbjct: 196 AAKTEAWARGLVQNFARQP 214


>gi|320155404|ref|YP_004187783.1| ferric iron ABC transporteriron-binding protein [Vibrio vulnificus
           MO6-24/O]
 gi|319930716|gb|ADV85580.1| ferric iron ABC transporter, iron-binding protein [Vibrio
           vulnificus MO6-24/O]
          Length = 337

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 82/188 (43%), Gaps = 11/188 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++ ++  + I    
Sbjct: 5   LTLSALACATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVMFAKTGIAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   ++ L+  + + +I+       +++  +   ++  T+
Sbjct: 65  AQEGEYSPADVILTVDISRLAELTDKGLVQPVNSEIIEANVPAQYQDKENEWFALTTRTR 124

Query: 123 VLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
            +  S  R+    L  S    DL   ++K ++        ++  L++ M     +   + 
Sbjct: 125 SVYSSRDRV--GKLGDSFTYEDLAKPEFKGKICTRSGKHPYNISLVSAMIAHHGEAETKK 182

Query: 180 FIKNITAN 187
           +++ + AN
Sbjct: 183 WLEGVKAN 190


>gi|220933641|ref|YP_002512540.1| extracellular solute-binding protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219994951|gb|ACL71553.1| extracellular solute-binding protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 345

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 75/169 (44%), Gaps = 9/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISP---IYTSSIQRPPIT-QGSPVDVIITKDE 82
             + +Y+ + ++++ P++  F E+TG++++         +QR     + SP D++IT D 
Sbjct: 28  GEVNVYSARQEALIKPLLDEFTEQTGIRVNLVTARAGELLQRLRAEGRNSPADLLITVDA 87

Query: 83  TSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
            +L  A    +L  + + ++        ++       +S   + +      +   ++ + 
Sbjct: 88  GNLHNAREAGVLAAVDSPVMADAIPPQYRDPEGYWFGLSMRARPIMVREGSVPEGEI-RR 146

Query: 140 VFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DLT+A+++ R+ +  + NI    ++  M  T  +   + +   +  N
Sbjct: 147 YEDLTDARYRGRICVRSSENIYNQSMIAAMIATLGEASTEAWAGGLVNN 195


>gi|3978164|gb|AAD03802.1| iron binding protein FbpA precursor [Mannheimia haemolytica]
 gi|110735169|gb|ABG89155.1| periplasmic iron binding protein A FbpA precursor [Mannheimia
           haemolytica]
          Length = 342

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 39/195 (20%), Positives = 90/195 (46%), Gaps = 13/195 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+T+    +    FT   ++      + +Y+ +   ++ P++ +FE+ TG+K++ I+  
Sbjct: 1   MKKTLSALAIAAATFTS--TSTLAANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFAD 58

Query: 62  -SIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DV++T D + +   +N DL  K+ + +++K      ++ N +  
Sbjct: 59  KGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWF 118

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++   +V+  S  R+    LP      DL   ++K ++ +     S++  L   M +  
Sbjct: 119 GLTTRARVIYTSKDRV--GKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHY 176

Query: 173 NKTVVQDFIKNITAN 187
                + F++ + AN
Sbjct: 177 GIEKTKAFLEGLKAN 191


>gi|261491687|ref|ZP_05988268.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494450|ref|ZP_05990936.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309834|gb|EEY11051.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312640|gb|EEY13762.1| iron binding protein FbpA precursor [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 342

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/195 (20%), Positives = 90/195 (46%), Gaps = 13/195 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+T+    +    FT   ++      + +Y+ +   ++ P++ +FE+ TG+K++ I+  
Sbjct: 1   MKKTLSALAIAAATFTS--TSTLAANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFAD 58

Query: 62  -SIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DV++T D + +   +N DL  K+ + +++K      ++ N +  
Sbjct: 59  KGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWF 118

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++   +V+  S  R+    LP      DL   ++K ++ +     S++  L   M +  
Sbjct: 119 GLTTRARVIYTSKDRV--GKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHY 176

Query: 173 NKTVVQDFIKNITAN 187
                + F++ + AN
Sbjct: 177 GIEKTKAFLEGLKAN 191


>gi|326423865|ref|NP_760550.2| ferric iron ABC transporter iron-binding protein [Vibrio vulnificus
           CMCP6]
 gi|319999237|gb|AAO10077.2| Ferric iron ABC transporter, iron-binding protein [Vibrio
           vulnificus CMCP6]
          Length = 337

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 81/186 (43%), Gaps = 7/186 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++ ++  + I    
Sbjct: 5   LTLSALACATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVMFAKTGIAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   ++ L+  + + +I+       +++  +   ++  T+
Sbjct: 65  AQEGEYSPADVILTVDISRLAELTDKGLVQPVNSEIIEANVPAQYQDKENEWFALTTRTR 124

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFI 181
            +  S  R+       +  DL   ++K ++        ++  L++ M     +   + ++
Sbjct: 125 SVYSSRDRVGKLGDAFTYEDLAKPEFKGKICTRSGKHPYNISLVSAMIAHHGEAETKKWL 184

Query: 182 KNITAN 187
           + + AN
Sbjct: 185 EGVKAN 190


>gi|260431831|ref|ZP_05785802.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415659|gb|EEX08918.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 337

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 76/175 (43%), Gaps = 10/175 (5%)

Query: 21  STENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPITQ----GSPVDV 76
            +      L LY+ ++      +   FEE TG+KI+ I   + +     +     SP DV
Sbjct: 17  GSAAAEGELNLYSSRHYDTDERLYTDFEEATGIKINRIEGKADELIARMEAEGANSPADV 76

Query: 77  IITKDETSLAL--NEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKI 133
           ++T D + LA   N  LL  + + ++ ++    L++E+ +    S   +++ Y    +  
Sbjct: 77  LLTVDTSRLARAKNAGLLQAVDSDVLEERIPANLQDEDNQWFGFSQRARIIFYDKNDVT- 135

Query: 134 ADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            + P +  DL N ++K  + I +  N     LL ++         +++   + AN
Sbjct: 136 -NPPATYLDLANPEYKGLVCIRSSTNTYNQTLLASIITHHGAEKAKEWAAGVVAN 189


>gi|332288543|ref|YP_004419395.1| thiamine transporter substrate binding subunit [Gallibacterium
           anatis UMN179]
 gi|330431439|gb|AEC16498.1| thiamine transporter substrate binding subunit [Gallibacterium
           anatis UMN179]
          Length = 336

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 82/187 (43%), Gaps = 11/187 (5%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT--SSIQRPP 67
           L  +   T   ++      + +Y+ +   ++ PI+  FE+ +G+K++ IY     ++R  
Sbjct: 5   LSAIACLTTFATSAFAANEVNVYSYRQPYLIEPILKQFEQESGIKVNFIYADKGLVERVK 64

Query: 68  IT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
              + SP DV++T D + +   +N  L   + + ++        ++   K   ++   +V
Sbjct: 65  REGELSPADVLLTVDISRVMEIVNAGLAQPIQSKVLDSNIPAQFRDSQGKWFALTSRARV 124

Query: 124 LAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDF 180
           +  S  R+    LP S   +DL   + K ++ +     S++  L+ +M         + F
Sbjct: 125 VYSSKDRV--GKLPASFTYYDLAKPELKGKVCVRSGKHSYNVSLVASMIAHDGVEKAKAF 182

Query: 181 IKNITAN 187
           +  + AN
Sbjct: 183 LTGLKAN 189


>gi|323490828|ref|ZP_08096029.1| extracellular solute-binding protein family 1 [Planococcus
           donghaensis MPA1U2]
 gi|323395540|gb|EGA88385.1| extracellular solute-binding protein family 1 [Planococcus
           donghaensis MPA1U2]
          Length = 349

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 73/174 (41%), Gaps = 9/174 (5%)

Query: 22  TENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVI 77
            E     + LYT ++  V   +   FEE TG+K++ I   + +           +  D+ 
Sbjct: 29  EETDGNEVNLYTARHYDVDDELYKKFEEETGIKVNLIKGDADELLERIKREGDATEADLF 88

Query: 78  ITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLAYSTKRIKIA 134
           +T D   L  A  + LL  + + L++ +     ++ ++    ++   +V+ Y+   +   
Sbjct: 89  LTADAGRLFRAKEDGLLQTVTSDLLEEQIPENYRDTDQMWYGLTKRARVIVYNQDTVTPE 148

Query: 135 DLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           DL  +   LT  QW  R+ I  + NI    LL +  +   +   +++   +  N
Sbjct: 149 DL-STYDALTEDQWNGRVLIRSSENIYNQSLLASFIEIDGEEQAKEWAAGLVKN 201


>gi|37680930|ref|NP_935539.1| ABC-type Fe3+ transport system, periplasmic component [Vibrio
           vulnificus YJ016]
 gi|37199680|dbj|BAC95510.1| ABC-type Fe3+ transport system, periplasmic component [Vibrio
           vulnificus YJ016]
          Length = 337

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 81/186 (43%), Gaps = 7/186 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++ ++  + I    
Sbjct: 5   LTLSALACATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVMFAKTGIAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   ++ L+  + + +I+       +++  +   ++  T+
Sbjct: 65  AQEGEYSPADVILTVDISRLAELTDKGLVQPVNSEIIEANVPAQYQDKENEWFALTTRTR 124

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFI 181
            +  S  R+       +  DL   ++K ++        ++  L++ M     +   + ++
Sbjct: 125 SVYSSRDRVGKLGDAFTYEDLAKPEFKGKICTRSGKHPYNISLVSAMIAHHGEAETKKWL 184

Query: 182 KNITAN 187
           + + AN
Sbjct: 185 EGVKAN 190


>gi|83647189|ref|YP_435624.1| Fe3+ ABC transporter periplasmic protein [Hahella chejuensis KCTC
           2396]
 gi|83635232|gb|ABC31199.1| ABC-type Fe3+ transport system, periplasmic component [Hahella
           chejuensis KCTC 2396]
          Length = 340

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 78/192 (40%), Gaps = 9/192 (4%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS 62
           K        LL  F          + + +Y+ + + ++ P++ +F  +T +K++ ++   
Sbjct: 4   KTASVFKAALLSTFCLTPLAAQAAEEVNVYSYRQEFLIQPLLDTFTSQTNIKVNVVFAKE 63

Query: 63  I---QRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMR 116
               +       SP D++++ D   L    +  +L  + + ++        + ++     
Sbjct: 64  GVAERLKREGANSPADLVLSTDIGQLQELTDAKVLQPVKSDVLNANIPEQYQAQDDSWFG 123

Query: 117 ISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKT 175
           ++   +V+  S +R ++  +  S  DL   +WK R+        ++  L  +M     + 
Sbjct: 124 LTARARVIYASKERTEVKSI--SYEDLAKPEWKGRICTRSGKHPYNIALFASMIAHHGEA 181

Query: 176 VVQDFIKNITAN 187
             +++++ +  N
Sbjct: 182 KTEEWLRGLKEN 193


>gi|159184207|ref|NP_353236.2| ABC transporter, substrate binding protein (iron) [Agrobacterium
           tumefaciens str. C58]
 gi|159139537|gb|AAK86021.2| ABC transporter, substrate binding protein (iron) [Agrobacterium
           tumefaciens str. C58]
          Length = 354

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 76/194 (39%), Gaps = 10/194 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-T 60
            K      +                  + +Y+ +   ++ P++ +F + TG++ + ++  
Sbjct: 9   LKSRFSAAVFSGLTILSLAPAALAEGEVNVYSYRQPELIQPLLDAFTKETGIETNVLFLD 68

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLA-LNED-LLHKL--PAHLIKKNSFVLKNENKKL 114
             +      +G  SP DV++T D   L    E  +   +     + K     L++   + 
Sbjct: 69  KGLVERIQAEGVNSPADVLLTVDIARLVEAKEGKVTQPVLADPVIEKDIPANLRDPEGEW 128

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPN 173
             ++   +V+  S +R+   D+  +  +L + +WK ++ I     S++  L+ +M     
Sbjct: 129 FGLTTRGRVVYASKERVTQKDI--TYEELADPKWKGKICIRDGQHSYNIALIASMIAHHG 186

Query: 174 KTVVQDFIKNITAN 187
               + ++  +  N
Sbjct: 187 VDYTRTWLTGLKNN 200


>gi|114569518|ref|YP_756198.1| extracellular solute-binding protein [Maricaulis maris MCS10]
 gi|114339980|gb|ABI65260.1| extracellular solute-binding protein, family 1 [Maricaulis maris
           MCS10]
          Length = 353

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 73/181 (40%), Gaps = 9/181 (4%)

Query: 15  GFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQ 70
             +         + + +Y+ ++ S    I  +F E TG++++ +  +  Q         +
Sbjct: 25  SASGDSEAAAEARVVNVYSARHYSSDAAIYAAFTESTGIEVNLVSANGDQLIERVRADGE 84

Query: 71  GSPVDVIITKDETSL--ALNEDLLHKLP-AHLIKKNSFVLKNENKKLMRISFDTQVLAYS 127
            SP DVIIT D   L  A    L      + L       L +     +  +  ++V+AYS
Sbjct: 85  RSPADVIITVDAARLHRAEQAGLFASADYSDLASGIGANLIDPEGYWVSFAKRSRVIAYS 144

Query: 128 TKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITA 186
             R++  ++  +  DL + +W+ R+ +  + N     LL  M     +   Q + + I  
Sbjct: 145 NDRVQPGEI-ATYEDLADPRWEGRICVRESGNAYNQSLLAAMVAHLGEDGAQAWAQGIVD 203

Query: 187 N 187
           N
Sbjct: 204 N 204


>gi|117921954|ref|YP_871146.1| extracellular solute-binding protein [Shewanella sp. ANA-3]
 gi|117614286|gb|ABK49740.1| extracellular solute-binding protein, family 1 [Shewanella sp.
           ANA-3]
          Length = 335

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 80/184 (43%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             L G      + +  + LT+Y+ +   ++ PI+  F + TG+ ++ ++    I      
Sbjct: 7   AALLGLMSVAQSAHADEKLTVYSYRQAFLVEPILKRFTDETGIAVNVVFAKDGIAERIAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   +++DL   + +  +        ++ + +   ++   + L
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVDKDLTSPVKSDQLNSNIPAQYRDPDGQWYALTMRVRNL 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +  S  +L + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YTAKDRLGPQAI--SYEELADPKYKGKICTRSGKHPYNIALVASMIAHHGEADTKTWLQG 184

Query: 184 ITAN 187
           +  N
Sbjct: 185 VKTN 188


>gi|227328888|ref|ZP_03832912.1| ABC transporter, substrate binding protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 349

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 82/195 (42%), Gaps = 16/195 (8%)

Query: 3   KRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--T 60
           K+     L        A         LTLYT +   ++ P++ +F + T VK++ ++   
Sbjct: 10  KKARLLTLASSIMVAYALPAAAADDSLTLYTTREPGLIQPLLDAFTKDTSVKVNTVFIKD 69

Query: 61  SSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKL-PAHLIKKNSFVLKNENKKLMR 116
             ++R     Q SP D+++T D  +L   ++  +   +  + L +     L++++ +   
Sbjct: 70  GMLERVKAEGQNSPADLLMTVDAGNLIDLVDAGVTQPIQSSALTEAIPAALRDKDNQWFG 129

Query: 117 ISFDTQVLAYSTKRIKIADLP---KSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTP 172
           +S  ++VL           LP    +  +L + +WK ++ I A  +     L+  M    
Sbjct: 130 LSMRSRVL------YAEKSLPLTGITYENLADPKWKGKVCIRAGQHPYNTALVAAMIAHH 183

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ +  N
Sbjct: 184 GEAKTETWLRGVKDN 198


>gi|261822236|ref|YP_003260342.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
 gi|261606249|gb|ACX88735.1| extracellular solute-binding protein family 1 [Pectobacterium
           wasabiae WPP163]
          Length = 348

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 82/194 (42%), Gaps = 10/194 (5%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPI-- 58
           + ++      L                 LTLYT +   ++ P++ +F + T V ++ +  
Sbjct: 7   VLRKKARLLTLASSLMVAYALPAAAEDSLTLYTTREPGLIQPLLDAFTKETSVNVNTVFI 66

Query: 59  YTSSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKL 114
               ++R     Q SP D+++T D  +L   +   +   + +  +       L++++ + 
Sbjct: 67  KDGMLERVKAEGQNSPADLLMTVDAGNLIDLVEAGVTQPIQSSTLTDVIPAALRDKDNQW 126

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
             +S  ++VL Y+ K + +  +  +  +L + +WK ++ I A  +     L+  M     
Sbjct: 127 FGLSMRSRVL-YAEKSLPLTSI--TYENLADPKWKGKVCIRAGQHPYNTALVAAMIAHHG 183

Query: 174 KTVVQDFIKNITAN 187
           +   + +++ +  N
Sbjct: 184 EAKTETWLRGVKEN 197


>gi|146284378|ref|YP_001174531.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           stutzeri A1501]
 gi|145572583|gb|ABP81689.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           stutzeri A1501]
 gi|327482761|gb|AEA86071.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 333

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 69/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
                    + +Y+ +   ++ P+  ++ ++TGV I  I                 +P D
Sbjct: 17  SGAVQAADEVVVYSSRIDELIKPVFDAYTKKTGVAIKFITDKEAPLMARIKAEGANTPAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  L + ++        ++ +     +S   + + YS +R+K
Sbjct: 77  LLLTVDGGNLWQAEEMGILQPLNSQVVKDNIPAQYRSSSDAWTGLSLRARTIVYSPERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +  +   +   L  TM +T      +  +K    N
Sbjct: 137 DGEL-TTYEALADKNWEGRLCLRTSKKVYNQSLTATMIETHGAEKTEQILKGWVNN 191


>gi|113971677|ref|YP_735470.1| extracellular solute-binding protein [Shewanella sp. MR-4]
 gi|113886361|gb|ABI40413.1| extracellular solute-binding protein, family 1 [Shewanella sp.
           MR-4]
          Length = 335

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 81/184 (44%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             L G     ++ +  + LT+Y+ +   ++ PI+  F E TG+ ++ ++    I      
Sbjct: 7   AALLGLMSVANSASADETLTVYSYRQPFLVEPILKRFTEETGIGVNFVFAKDGIAERIAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   +++DL   + +  +        ++ + +   ++   + L
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVDKDLTSPVKSEQLNSNIPAQYRDPDGQWYALTMRVRNL 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +  S  +L + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YTAKDRLGPQAI--SYEELADPKYKGKICTRSGKHPYNIALVASMIAHHGEADTKTWLQG 184

Query: 184 ITAN 187
           +  N
Sbjct: 185 VKTN 188


>gi|113460926|ref|YP_718993.1| periplasmic iron-binding protein [Haemophilus somnus 129PT]
 gi|170717479|ref|YP_001784574.1| extracellular solute-binding protein [Haemophilus somnus 2336]
 gi|112822969|gb|ABI25058.1| periplasmic iron-binding protein [Haemophilus somnus 129PT]
 gi|168825608|gb|ACA30979.1| extracellular solute-binding protein family 1 [Haemophilus somnus
           2336]
          Length = 338

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 88/195 (45%), Gaps = 13/195 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
            K+++ T  L L     A +       + +Y+ +   ++ PI+  FE+ TG+K++ ++  
Sbjct: 1   MKKSLSTLTLALAATVSASAL--AANEVNVYSYRQPYLIEPILKEFEKETGIKVNVLFDN 58

Query: 61  -SSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
              ++R     + SP DV++T D   +   +N  L   + + +++K      ++ N +  
Sbjct: 59  KGLVERVKREGELSPADVLLTVDIKRVMEIVNAGLAQPIHSEILEKNIPAQYRDANDQWF 118

Query: 116 RISFDTQVLAYSTKRIKIADLPK--SVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++   + +  S  R+    LP   + +DL   + K ++ +     +++  L+ +M    
Sbjct: 119 GLTTRARAIYTSKDRV--GKLPADFTYYDLAKPELKGKVCVRSGKHTYNVSLVASMIAHD 176

Query: 173 NKTVVQDFIKNITAN 187
            +   + F++ +  N
Sbjct: 177 GEAKAKAFLEGLKNN 191


>gi|329889653|ref|ZP_08267996.1| extracellular solute-binding protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844954|gb|EGF94518.1| extracellular solute-binding protein [Brevundimonas diminuta ATCC
           11568]
          Length = 409

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 66/179 (36%), Gaps = 9/179 (5%)

Query: 17  TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPP----ITQGS 72
                       L LYT ++      +   F E+TG+++  I     +           S
Sbjct: 84  DAPVDKAGQAGVLNLYTARHYDADQKLYDLFAEKTGIEVKRIEGKPDELIARMKAEGANS 143

Query: 73  PVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTK 129
           P D+ I  D  +L  A +  L     +  + +     L+  + +    S   +V+AY   
Sbjct: 144 PADIFIAADAGALWRAQDAGLFQTTNSGTLNQTIPANLRAPDGQWFGFSRRARVVAYDPA 203

Query: 130 RIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
           ++K  ++      L   ++K +L +    N+    L+  + +       + +++ + AN
Sbjct: 204 KVKPEEI-DDYAKLAGPRFKGKLCVRSGDNVYNLSLVGALIEAWGPERAKQWVEGVVAN 261


>gi|330952093|gb|EGH52353.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae Cit 7]
          Length = 333

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 71/176 (40%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++   TGVKI  I               Q +P D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGQNAPAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            A+L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PAEL-STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|87302659|ref|ZP_01085476.1| putative iron ABC transporter, substrate binding protein
           [Synechococcus sp. WH 5701]
 gi|87283003|gb|EAQ74960.1| putative iron ABC transporter, substrate binding protein
           [Synechococcus sp. WH 5701]
          Length = 359

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 68/169 (40%), Gaps = 9/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVDVIITKDE 82
           + + +Y+ ++ +    +   F E+TG+K++ +     +          GSP DV++  D 
Sbjct: 48  QEVNVYSGRHYNTDKELYKQFTEKTGIKVNLLEGKDDELIVRLKSEGAGSPADVLVLVDA 107

Query: 83  TSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             +  A  E+L   + +  + +     L++       ++   + +  +   +  A L  +
Sbjct: 108 ARIQRARQEELFQPISSAALNRDVPASLRDPAGSWYALTRRARPIMVNPALVDPASL-ST 166

Query: 140 VFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             DL   + K +L +    ++    L+  +         + +++ + AN
Sbjct: 167 YADLARPELKGKLCLRNRASVYNQSLVADILVQKGSAATRTWLEGLVAN 215


>gi|146277155|ref|YP_001167314.1| extracellular solute-binding protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555396|gb|ABP70009.1| extracellular solute-binding protein, family 1 [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 336

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 27/191 (14%), Positives = 76/191 (39%), Gaps = 10/191 (5%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSS 62
           R      + L   T A       + + +Y+ +   ++ P++ +F   TG+ ++  +    
Sbjct: 2   RPAIASSIALALCTTALPAL--AEEVNIYSHRQPELIQPLVDAFSAETGIDVNVAFVDKG 59

Query: 63  IQRPPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +    + +G  SP D+++T D   L   ++  +   + + ++        ++       +
Sbjct: 60  MAERLVAEGDRSPADLVLTVDIARLMQVVDAGVTQPVESEVLDANIPESFRDPEGHWFGL 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAP-NNISFHRLLNTMEQTPNKTV 176
           +   +++  S +R+   ++  +  DL + +WK R+      N     L   +        
Sbjct: 120 TSRARIVYASKERVADGEV-TTYEDLASEKWKGRICTRSFTNDYNVALTGAVLAHHGAEA 178

Query: 177 VQDFIKNITAN 187
            + +++ + AN
Sbjct: 179 ARSWLEGVKAN 189


>gi|330831206|ref|YP_004394158.1| iron(III) ABC transporter periplasmic protein [Aeromonas veronii
           B565]
 gi|328806342|gb|AEB51541.1| ABC-type iron(III) transporter, periplasmic component [Aeromonas
           veronii B565]
          Length = 335

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 27  KYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPIT-QG--SPVDVIITKDET 83
             + +Y+++   ++ PII  FE+ +G+K++ ++        +  +G  SP D+++T D +
Sbjct: 22  GEVNVYSNRQDELIKPIIQQFEKESGIKVNVVFAKEGLNERLEREGKLSPADLMLTVDIS 81

Query: 84  SLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPK-S 139
            L   +++ L+  + + ++ +    + ++   +   ++   + +  S  R+    L   S
Sbjct: 82  RLTDLVDKGLVQPVDSKILQENIPTIYRDPENRWFALTTRVRAIYSSKDRL--GKLETIS 139

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL   ++K ++        ++  L+++M         + +++ + AN
Sbjct: 140 YEDLAKPEFKGKICTRSGKHEYNVALVSSMIAHHGMAETKTWLEGVKAN 188


>gi|120597545|ref|YP_962119.1| extracellular solute-binding protein [Shewanella sp. W3-18-1]
 gi|146294314|ref|YP_001184738.1| extracellular solute-binding protein [Shewanella putrefaciens
           CN-32]
 gi|120557638|gb|ABM23565.1| extracellular solute-binding protein, family 1 [Shewanella sp.
           W3-18-1]
 gi|145566004|gb|ABP76939.1| extracellular solute-binding protein, family 1 [Shewanella
           putrefaciens CN-32]
 gi|319427676|gb|ADV55750.1| ABC iron(III) transporter, periplasmic ligand-binding subunit, FbpA
           [Shewanella putrefaciens 200]
          Length = 335

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 77/188 (40%), Gaps = 9/188 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQR 65
                 L G      +    + LT+Y+ +   ++ PI+  F E TG+ ++ ++    I  
Sbjct: 3   LVTYAALVGLISVGQSAFADEKLTVYSYRQAFLVEPILARFTEETGIGVNVVFAKDGIAE 62

Query: 66  PPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFD 120
               +G  SP D+++T D + L   + +DL   +    ++       ++ + +   ++  
Sbjct: 63  RIAREGRLSPADLVLTSDFSRLVELVEKDLTSPVKTPTLESNIPAQYRDPDGQWYALTMR 122

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
            + L  +  R     L  +  DL + ++K ++        ++  L+ +M     +   + 
Sbjct: 123 VRNLYTAKDRAGSQQL--TYEDLADPKYKGKICTRSGKHPYNIALVASMIAHHGEAEAKT 180

Query: 180 FIKNITAN 187
           +++ +  N
Sbjct: 181 WLQGVKTN 188


>gi|298290610|ref|YP_003692549.1| extracellular solute-binding protein family 1 [Starkeya novella DSM
           506]
 gi|296927121|gb|ADH87930.1| extracellular solute-binding protein family 1 [Starkeya novella DSM
           506]
          Length = 349

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 82/193 (42%), Gaps = 9/193 (4%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
             R +     L  G   A    +  + + +YT +   +  P+  +F  +TGVK++ ++  
Sbjct: 9   LARRLAVAGSLAAGLALAPLGASAEEVVNIYTTREPGLAKPLFDAFTAKTGVKVNSVFVK 68

Query: 62  S--IQRPPIT-QGSPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
               +R     +GSP DV++T D  SL   +++ +   + + +++K     L+  +    
Sbjct: 69  DGLAERVKAEGEGSPADVLMTVDIGSLLDLVDQGVTQPVKSDVLEKAIPANLRAPDGSWY 128

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNN-ISFHRLLNTMEQTPNK 174
            +S   +V   S  R+K+  +  +  D  + ++K  + I          L+        +
Sbjct: 129 ALSARARVAYLSKDRVKLDAI--TYEDFADPKYKGEVCIRSGKHPYNTALIAAYIVHHGE 186

Query: 175 TVVQDFIKNITAN 187
              ++++K + AN
Sbjct: 187 AKAEEWLKGVKAN 199


>gi|312883986|ref|ZP_07743703.1| hypothetical protein VIBC2010_01848 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368444|gb|EFP95979.1| hypothetical protein VIBC2010_01848 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 337

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 84/188 (44%), Gaps = 11/188 (5%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPP 67
             L     +         + + +Y+ +   ++ P+   F + TG+K++  +    +    
Sbjct: 5   LTLSALACSTIAPVAMAAEEVNVYSYRQPFLVEPMFDEFTKETGIKVNVKFAKKGLAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   ++ L+ K+ + +++K      ++++ +   ++  T+
Sbjct: 65  AQEGEYSPADVILTVDISRLAELTDKKLVQKVDSKVLEKNIPAQYQDKDNEWFALTTRTR 124

Query: 123 VLAYSTKRIKI--ADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
            +  S  R+     D   +  DL   ++K ++        ++  L+++M     +   ++
Sbjct: 125 SVYSSRDRVGRLGDDF--TYSDLAKPEFKGKICTRSGKHPYNVSLVSSMIAHKGEAETKE 182

Query: 180 FIKNITAN 187
           ++K + AN
Sbjct: 183 WLKGVKAN 190


>gi|160900175|ref|YP_001565757.1| extracellular solute-binding protein [Delftia acidovorans SPH-1]
 gi|160365759|gb|ABX37372.1| extracellular solute-binding protein family 1 [Delftia acidovorans
           SPH-1]
          Length = 348

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 79/193 (40%), Gaps = 13/193 (6%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ-- 64
              L   C    A +    ++ + LY+ ++ S    + + F + TG+KI+ +        
Sbjct: 5   LKALFAACALVAAGTAIADSQVVNLYSARHYSTDEELYNGFTKATGIKINRVDGDDAGII 64

Query: 65  --RPPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKN---ENK-KLM 115
                  Q SP DVI+  D   L     + L   + + L+       L+     +     
Sbjct: 65  ARLKAEGQASPADVILLVDAARLYRGEVDGLFQPIHSKLLEDAIPSNLRAQPTADGISWF 124

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNK 174
            +S   +V+ Y+  +++ AD+ ++   L + ++K +L I + ++     L  T+ +    
Sbjct: 125 GLSTRARVIVYNKAKVQPADV-QNYESLADPKFKGQLCIRSGSHPYNLSLFGTVVEHMGD 183

Query: 175 TVVQDFIKNITAN 187
              + +I+ + AN
Sbjct: 184 QKAEGWIQGMKAN 196


>gi|262273783|ref|ZP_06051596.1| ferric iron ABC transporter iron-binding protein [Grimontia
           hollisae CIP 101886]
 gi|262222198|gb|EEY73510.1| ferric iron ABC transporter iron-binding protein [Grimontia
           hollisae CIP 101886]
          Length = 335

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 80/189 (42%), Gaps = 8/189 (4%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQ 64
           + +   L+ G           + + +Y+ +   ++ P++ +F + TG+K++  +    + 
Sbjct: 1   MLSASALMLGVM-GTGVAQAAEEVNVYSYRQPFLIEPMLDAFTKETGIKVNVKFAKEGLA 59

Query: 65  RPPITQG--SPVDVIITKDETSLAL--NEDLLHKLPAHLIKK-NSFVLKNENKKLMRISF 119
                +G  SP DV++T D   L    N+DL+  L + +I+       ++ N +   ++ 
Sbjct: 60  EKLQQEGEYSPADVLLTVDIARLKELDNKDLVQALDSEVIESNVPAQFRDSNDRWFALTL 119

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQ 178
             + +  S  R+          DL   ++K ++        ++  L++ +     +   +
Sbjct: 120 RARGVYSSRDRVGKLGNDFDYMDLAKPEFKGKICTRSGKHPYNVSLISAVIANHGEAEAK 179

Query: 179 DFIKNITAN 187
            +++ + AN
Sbjct: 180 AWLEGVKAN 188


>gi|104784216|ref|YP_610714.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           entomophila L48]
 gi|95113203|emb|CAK17931.1| putative iron ABC transporter, periplasmic iron-binding protein
           [Pseudomonas entomophila L48]
          Length = 333

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 72/176 (40%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++  +TGVKI  I               +    D
Sbjct: 17  GGTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENGVAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L  + + +I K      +  +     +S   + +AYST+R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPIKSDIIDKNIPAQYRASSHDWTGLSLRARTIAYSTERVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            ++L  +   L +  W+ RL +      +   L  T+ +   +   +  +K+   N
Sbjct: 137 PSEL-STYEALADKNWEGRLCLRTAKKVYNQSLTATLIENHGEAATEKLVKDWVNN 191


>gi|294139549|ref|YP_003555527.1| iron(III) ABC transporter periplasmic iron(III)-binding protein
           [Shewanella violacea DSS12]
 gi|293326018|dbj|BAJ00749.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella violacea DSS12]
          Length = 335

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 84/184 (45%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           + + G     S  N  + LT+Y+ +   ++ PI+  F + TG+++  +++   I    + 
Sbjct: 7   MAILGLVCFASVANAAENLTVYSYRQAFLVEPILAKFTKETGIEVDVVFSKKGIAERMMR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   ++++L+  + + L+K       ++       ++   + +
Sbjct: 67  EGRLSPADIVLTSDFSRLMELVDKNLVIPVDSELLKTNIPAKYRSPEDTWYALTMRVRNI 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S  R+   D+     DL + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YSSKDRMGKLDI--DYEDLADPKYKGKICTRSGKHPYNISLVASMIAHHGEAETKTWLEG 184

Query: 184 ITAN 187
             AN
Sbjct: 185 WKAN 188


>gi|229593244|ref|YP_002875363.1| putative iron (III) ABC transporter substrate-binding protein
           [Pseudomonas fluorescens SBW25]
 gi|229365110|emb|CAY53330.1| putative iron (III) ABC transport system, substrate-binding protein
           [Pseudomonas fluorescens SBW25]
          Length = 334

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 73/177 (41%), Gaps = 9/177 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPV 74
             +T      + +Y+ +   ++ P+  ++ ++TGV++  I               + +  
Sbjct: 17  GSTTVQAADEVVVYSSRIDELIKPVFDAYTQKTGVQVKFITDKEAPLMQRIKAEGENATA 76

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           D+++T D  +L   E   +L    + +I K      ++       +S   + +AYST R+
Sbjct: 77  DLLLTVDAGNLWQAEQMGILQPFTSAVIDKNIPLQYRSSKHAWTGLSLRARTIAYSTDRV 136

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           K  DL  +   L + QW+ RL +      +   L  T+ +T      ++ +K    N
Sbjct: 137 KPGDL-TTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAAKTEEIVKGWVNN 192


>gi|237817008|ref|ZP_04596000.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Brucella abortus str. 2308 A]
 gi|237787821|gb|EEP62037.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein [Brucella abortus str. 2308 A]
          Length = 394

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 83/189 (43%), Gaps = 11/189 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSI 63
           I    L L   T      +  + + LYT +   ++ P++ +F+  TG+ ++ ++      
Sbjct: 59  IARSALALVAVTLVTGAAHADE-VNLYTTREPGLIQPLLDAFKSSTGITVNTVFLKDGLA 117

Query: 64  QRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISF 119
           +R     + SP D+++T D  +L    ++ L   + + ++ +     L++ +     +S 
Sbjct: 118 ERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVLKEAVPAQLRDADGDWYALSM 177

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V  Y+ K ++I  +  +  +L++ +WK ++ I A  +     L             +
Sbjct: 178 RARV-VYADKDMEIDKI--TYEELSDPKWKGKICIRAGQHPYNTALFADYIAHHGVAKTE 234

Query: 179 DFIKNITAN 187
           +++  + AN
Sbjct: 235 EWLAGLKAN 243


>gi|254502107|ref|ZP_05114258.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438178|gb|EEE44857.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
          Length = 343

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 87/194 (44%), Gaps = 10/194 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           F+ T+    L       +      T  L LY+ ++      +   FEE++G+KI+ I   
Sbjct: 4   FRSTVSRSGLAAALLIASSPLALATGELNLYSSRHYDTDERLYSDFEEQSGIKINRIEGK 63

Query: 62  SIQRP----PITQGSPVDVIITKDETSLALNE--DLLHKLPAHLIKKNSFVL-KNENKKL 114
           + +         Q SP D+++T D + L   +   LL  + + ++++      ++++ + 
Sbjct: 64  ADELLTRMEAEGQNSPADILLTVDTSRLERAKGMGLLQSVESPVLEQRLPGYVQDDDNQW 123

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPN 173
              S   +++ Y  +++  A+ P++  DL + ++K  + I + +N+    +   + +   
Sbjct: 124 FGFSQRARIIFYDKEKV--AEPPRTYQDLADPKYKGMICIRSSSNVYTQTITAALIEHLG 181

Query: 174 KTVVQDFIKNITAN 187
           +  V+D+   +  N
Sbjct: 182 EEAVKDWATAVVGN 195


>gi|225629178|ref|ZP_03787211.1| iron compound ABC transporter periplasmic iron compound-binding
           protein [Brucella ceti str. Cudo]
 gi|225615674|gb|EEH12723.1| iron compound ABC transporter periplasmic iron compound-binding
           protein [Brucella ceti str. Cudo]
          Length = 393

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 83/189 (43%), Gaps = 11/189 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSI 63
           I    L L   T      +  + + LYT +   ++ P++ +F+  TG+ ++ ++      
Sbjct: 59  IARSALALVAVTLVTGAAHADE-VNLYTTREPGLIQPLLDAFKSSTGITVNTVFLKDGLA 117

Query: 64  QRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISF 119
           +R     + SP D+++T D  +L    ++ L   + + ++ +     L++ +     +S 
Sbjct: 118 ERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVLKEAVPAQLRDADGDWYALSM 177

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V  Y+ K ++I  +  +  +L++ +WK ++ I A  +     L             +
Sbjct: 178 RARV-VYADKDMEIDKI--TYEELSDPKWKGKICIRAGQHPYNTALFADYIAHHGVAKTE 234

Query: 179 DFIKNITAN 187
           +++  + AN
Sbjct: 235 EWLAGLKAN 243


>gi|70733249|ref|YP_263022.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347548|gb|AAY95154.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens Pf-5]
          Length = 333

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
             T      + +Y+ +   ++ P+  ++ ++TGVKI  I               + +  D
Sbjct: 17  GGTAYAADEVVVYSSRIDELIKPVFDAYTQKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I        ++ N     +S   + LAYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSKVIDSNIPLQYRSSNHAWTGLSLRARTLAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            ++L  +   L + QW+ RL +      +   L  T+ +T      ++ IK    N
Sbjct: 137 PSEL-TTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAEKTEEIIKGWVNN 191


>gi|323492006|ref|ZP_08097171.1| hypothetical protein VIBR0546_07899 [Vibrio brasiliensis LMG 20546]
 gi|323313735|gb|EGA66834.1| hypothetical protein VIBR0546_07899 [Vibrio brasiliensis LMG 20546]
          Length = 338

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SS 62
           + + T   L C  T A S     + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 2   KKLLTLSALACA-TIAPSAAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKG 60

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DVI+T D + L+    ++L+  + + +++K      ++ N +   +
Sbjct: 61  LAEKLAQEGEYSPADVILTVDISRLSELTKKNLVQAVESEVLEKNIPAQYQDTNNEWFAL 120

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  T+ +  S  R+       +  DL   ++K ++        ++  L++ M     +  
Sbjct: 121 TTRTRSVYSSRDRVGRLGEDFTYADLAKPEFKGKICTRSGKHPYNVSLVSAMIAHEGEAA 180

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 181 TKEWLEGVKAN 191


>gi|148558422|ref|YP_001257663.1| putative iron compound ABC transporter periplasmic iron
           compound-binding protein [Brucella ovis ATCC 25840]
 gi|148369707|gb|ABQ62579.1| putative iron compound ABC transporter, periplasmic iron
           compound-binding protein [Brucella ovis ATCC 25840]
          Length = 380

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 83/189 (43%), Gaps = 11/189 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSI 63
           I    L L   T      +  + + LYT +   ++ P++ +F+  TG+ ++ ++      
Sbjct: 46  IARSALALVAVTLVTGAAHADE-VNLYTTREPGLIQPLLDAFKSSTGITVNTVFLKDGLA 104

Query: 64  QRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISF 119
           +R     + SP D+++T D  +L    ++ L   + + ++ +     L++ +     +S 
Sbjct: 105 ERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVLKEAVPAQLRDADGDWYALSM 164

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V  Y+ K ++I  +  +  +L++ +WK ++ I A  +     L             +
Sbjct: 165 RARV-VYADKDMEIDKI--TYEELSDPKWKGKICIRAGQHPYNTALFADYIAHHGVAKTE 221

Query: 179 DFIKNITAN 187
           +++  + AN
Sbjct: 222 EWLAGLKAN 230


>gi|71906695|ref|YP_284282.1| extracellular solute-binding protein [Dechloromonas aromatica RCB]
 gi|71846316|gb|AAZ45812.1| extracellular solute-binding protein, family 1 [Dechloromonas
           aromatica RCB]
          Length = 337

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 76/176 (43%), Gaps = 9/176 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPV 74
           +F+T+   K L LY+ ++      +  +F ++TG+KI+ I     +           SP 
Sbjct: 15  SFATQAQEKVLNLYSARHYQTDEKLYDNFTKQTGIKINRIDGKEDELMERIRNEGANSPA 74

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           DV IT D   LA  +   L   + + L+++      + +      S   +V+ Y+   +K
Sbjct: 75  DVFITVDAARLANADALGLFAPVKSKLLERRIPAHLHTD-TWFAFSTRARVIIYNRSAVK 133

Query: 133 IADLPKSVFDLTNAQWKKRLS-IAPNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
             D+  +   L + + K +L   + ++     L+ ++     +   +++ K + AN
Sbjct: 134 AEDV-ATYESLADPKLKGKLCSRSGSHPYNLSLVASLIAHDGEAKTEEWAKGMVAN 188


>gi|237797926|ref|ZP_04586387.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331020777|gb|EGI00834.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 196

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I        ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIDANIPPQYRSSTHSWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            A+L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PAEL-TTYEALADKHWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|294853520|ref|ZP_06794192.1| iron(III) transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
 gi|294819175|gb|EFG36175.1| iron(III) transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
          Length = 380

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 83/189 (43%), Gaps = 11/189 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY--TSSI 63
           I    L L   T      +  + + LYT +   ++ P++ +F+  TG+ ++ ++      
Sbjct: 46  IARSALALVAVTLVTGAAHADE-VNLYTTREPGLIQPLLDAFKSSTGITVNTVFLKDGLA 104

Query: 64  QRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISF 119
           +R     + SP D+++T D  +L    ++ L   + + ++ +     L++ +     +S 
Sbjct: 105 ERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVLKEAVPAQLRDADGDWYALSI 164

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQ 178
             +V  Y+ K ++I  +  +  +L++ +WK ++ I A  +     L             +
Sbjct: 165 RARV-VYADKDMEIDKI--TYEELSDPKWKGKICIRAGQHPYNTALFADYIAHHGVAKTE 221

Query: 179 DFIKNITAN 187
           +++  + AN
Sbjct: 222 EWLAGLKAN 230


>gi|269966951|ref|ZP_06181023.1| Iron-utilization periplasmic protein [Vibrio alginolyticus 40B]
 gi|269828434|gb|EEZ82696.1| Iron-utilization periplasmic protein [Vibrio alginolyticus 40B]
          Length = 337

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 86/191 (45%), Gaps = 9/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SS 62
           + + T   L C       T    + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 2   KKLLTLSALTCATLA--PTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKG 59

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   +
Sbjct: 60  LAEKLAQEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFAL 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  ++ +  S  R+       +  DL   ++K ++        ++  L++ M     +  
Sbjct: 120 TLRSRSVYSSRDRVGKLGADFNYADLAKPEFKGKICTRSGKHPYNVSLVSAMIAHNGEAE 179

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 180 TKEWLEGVKAN 190


>gi|114769387|ref|ZP_01447013.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [alpha proteobacterium HTCC2255]
 gi|114550304|gb|EAU53185.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [alpha proteobacterium HTCC2255]
          Length = 336

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 73/183 (39%), Gaps = 8/183 (4%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISP---IYTSSIQRPPI 68
           +        +T      + +Y+ +   ++ P+  +F  ++G+K++          +    
Sbjct: 8   IFASALLTLATPTLANDVNVYSYRQAELVKPLFDAFTAQSGIKVNVQFLKKGLVEKLVAE 67

Query: 69  TQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISFDTQVLA 125
              SP DVI+T D + L   +   +   + + ++K       ++   +   ++   ++  
Sbjct: 68  GNRSPADVILTVDISRLNSVVEAGVTQPVVSEVLKNNIPAEFRDPENQWFALTTRARIAY 127

Query: 126 YSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNI 184
            S +R+   ++  +  D  + +WK R+   +  N     L + +     + V + ++  +
Sbjct: 128 ASKERVLDGEV-TTYEDFADPKWKNRICTRSGTNAYNLALTSAVIANHGEDVAKSWLLGV 186

Query: 185 TAN 187
            +N
Sbjct: 187 KSN 189


>gi|91228304|ref|ZP_01262233.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio alginolyticus 12G01]
 gi|91188120|gb|EAS74423.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio alginolyticus 12G01]
          Length = 334

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 82/186 (44%), Gaps = 7/186 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++  +    +    
Sbjct: 2   LTLSALTCATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKGLAEKL 61

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   ++  ++
Sbjct: 62  AQEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRSR 121

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFI 181
            +  S  R+       +  DL   ++K ++        ++  L++ M     +   ++++
Sbjct: 122 SVYSSRDRVGKLGADFNYADLAKPEFKGKICTRSGKHPYNVSLVSAMIAHNGEAETKEWL 181

Query: 182 KNITAN 187
           + + AN
Sbjct: 182 EGVKAN 187


>gi|330446871|ref|ZP_08310522.1| iron binding protein FbpA [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491062|dbj|GAA05019.1| iron binding protein FbpA [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 337

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 84/195 (43%), Gaps = 14/195 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K+ +   +L+      A       + + +Y+ +   ++ P+ + F + TG+K++  +  
Sbjct: 1   MKKLLAPAILMGLA---APQVATAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAK 57

Query: 62  S-IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             I      +G  SP DV++T D + L    ++ L+  + + +I        ++   +  
Sbjct: 58  QGIAEKLQQEGEYSPADVVLTTDISRLVELSDKKLVQSVDSKVIDSNVPAQFRDNEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKS--VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTP 172
            ++  ++ +  S  R+    LP S    DL   +WK ++        ++  L+++M    
Sbjct: 118 ALTLRSRNVYSSKDRV--GKLPASFDYSDLAKPEWKGKICTRSGKHPYNVSLVSSMIAHY 175

Query: 173 NKTVVQDFIKNITAN 187
            +   + +++ + AN
Sbjct: 176 GEAETKVWLEGVKAN 190


>gi|39654597|pdb|1Q35|A Chain A, Crystal Structure Of Pasteurella Haemolytica Apo Ferric
           Ion- Binding Protein A
 gi|49259000|pdb|1SI0|A Chain A, Crystal Structure Of Mannheimia Haemolytica Ferric Iron-
           Binding Protein A In A Closed Conformation
 gi|49259001|pdb|1SI1|A Chain A, Crystal Structure Of Mannheimia Haemolytica Ferric Iron-
           Binding Protein A In An Open Conformation
          Length = 320

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 81/171 (47%), Gaps = 11/171 (6%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS-SIQRPPITQG--SPVDVIITKDE 82
              + +Y+ +   ++ P++ +FE+ TG+K++ I+    +      +G  SP DV++T D 
Sbjct: 1   ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDI 60

Query: 83  TSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
           + +   +N DL  K+ + +++K      ++ N +   ++   +V+  S  R+    LP  
Sbjct: 61  SRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRV--GKLPAG 118

Query: 140 --VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
               DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 119 FDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 169


>gi|254508250|ref|ZP_05120374.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio parahaemolyticus 16]
 gi|219548867|gb|EED25868.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio parahaemolyticus 16]
          Length = 342

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 88/191 (46%), Gaps = 8/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SS 62
           + + T   L C  T A S     + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 6   KKLLTLSALACA-TIAPSAAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKG 64

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DVI+T D + LA   N+DL+  + + +++K      ++   +   +
Sbjct: 65  LAEKLAQEGEYSPADVILTVDISRLAELTNKDLVQAVQSDVLEKNIPAQYQDTENEWFAL 124

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  T+ +  S  R+       +  DL   ++K ++        ++  L+++M     +  
Sbjct: 125 TTRTRSVYSSRDRVGRLGEEFNYADLAKPEFKGKICTRSGKHPYNVSLVSSMIAHKGEAE 184

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 185 TKEWLEGVKAN 195


>gi|262371220|ref|ZP_06064540.1| extracellular solute-binding protein, family 1 [Acinetobacter
           johnsonii SH046]
 gi|262313827|gb|EEY94874.1| extracellular solute-binding protein, family 1 [Acinetobacter
           johnsonii SH046]
          Length = 338

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 83/184 (45%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPI-T 69
           LLL G      +      + LYT +   +M P++  F ++TGVK++ ++        +  
Sbjct: 9   LLLTGLVAFSGSWVHAAEVNLYTTREPVLMQPLLKEFSQKTGVKVNTVFIKDGLLERVKA 68

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP DV++T D  +L   +   L  ++ + ++ K     L+  N     +S   + +
Sbjct: 69  EGRRSPADVMLTVDFGNLVDLVESGLTQRVDSKILNKSIPGNLRAANGHWYALSMRARAV 128

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKN 183
             S  R+ ++ +  S  DL N +WK ++ I + ++     L+        +   + +++ 
Sbjct: 129 YVSKDRVPLSAI--SYEDLANPKWKGKICIRSGSHPYNTGLIAAYIAHHGEKEAETWLRG 186

Query: 184 ITAN 187
           + AN
Sbjct: 187 VKAN 190


>gi|197334707|ref|YP_002156950.1| iron(III) ABC transporter, periplasmic binding protein [Vibrio
           fischeri MJ11]
 gi|197316197|gb|ACH65644.1| iron(III) ABC transporter, periplasmic binding protein [Vibrio
           fischeri MJ11]
          Length = 337

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
            K+ +    L+   F     +    + + +Y+ +   ++ P+   F + TG++++  +  
Sbjct: 1   MKKLLSVSALIAGMFAP---SVMAAEEVNVYSYRQPFLVEPMFKEFTKETGIQVNVKFAK 57

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DVI+T D + LA   N++L+  + + +I        ++   +  
Sbjct: 58  KGLAEKLAQEGELSPADVILTTDISRLAELTNKNLVQPVDSKVIDANVPAQYRDAEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNK 174
            ++   + +  S  R+          DL   +WK ++        ++  L+++M     +
Sbjct: 118 ALTLRARNVYSSRDRVGKLGADFDYADLAKPEWKGKICTRSGKHPYNVSLVSSMIAHHGE 177

Query: 175 TVVQDFIKNITAN 187
              + +++ + +N
Sbjct: 178 AEAKTWLEGVKSN 190


>gi|126738244|ref|ZP_01753965.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. SK209-2-6]
 gi|126720741|gb|EBA17446.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. SK209-2-6]
          Length = 338

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 82/191 (42%), Gaps = 11/191 (5%)

Query: 6   IYTYLLLLCGFTEAFSTENTTK-YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ 64
           + T  +L      A +T    +  L LY+ ++      +   FEE TG+ I+ I   + +
Sbjct: 2   LKTSTILASALVGALATSAAAEGELNLYSSRHYDTDERLYSDFEEATGITINRIEGKADE 61

Query: 65  R----PPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLIK-KNSFVLKNENKKLMRI 117
                      SP DV++T D + LA   N  +L  + +  ++ +    L++ + +   +
Sbjct: 62  LIARMQAEGANSPADVLLTVDTSRLARAKNAGILQSIESDTLEARVPAYLQDSDNQWFGL 121

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTV 176
           S   +++ Y    +K  + P++  DL +  +  ++ I + +N     LL ++     +  
Sbjct: 122 SQRARIIFYDKNDLK--NPPRTYLDLADPAYAGKVCIRSSSNTYNQTLLASIVTHHGEEK 179

Query: 177 VQDFIKNITAN 187
             ++   + AN
Sbjct: 180 AAEWADGVVAN 190


>gi|24372333|ref|NP_716375.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella oneidensis MR-1]
 gi|24346281|gb|AAN53820.1|AE015520_1 iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella oneidensis MR-1]
          Length = 335

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 77/184 (41%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             L G      + +  + LT+Y+ +   ++ PI+  F E TG+ ++ ++    I      
Sbjct: 7   AALIGLMSVAQSAHADEKLTVYSYRQAFLVEPILKRFTEETGIGVNVVFAKDGIAERIAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKL-PAHLIKKNSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   + +DL   +  A L        ++   +   ++   + +
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVEKDLTSPVQSAQLDNNIPAQYRDPEGQWYALTMRVRNI 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +     +L + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YTAKDRLGPQAI--RYEELADPKYKGKICTRSGKHPYNIALVASMIAHHGEADTKTWLQG 184

Query: 184 ITAN 187
           +  N
Sbjct: 185 VKTN 188


>gi|262393347|ref|YP_003285201.1| ferric iron ABC transporter iron-binding protein [Vibrio sp. Ex25]
 gi|262336941|gb|ACY50736.1| ferric iron ABC transporter iron-binding protein [Vibrio sp. Ex25]
          Length = 337

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 86/191 (45%), Gaps = 9/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SS 62
           + + T   L C       T    + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 2   KKLLTLSALTCATLA--PTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKG 59

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   +
Sbjct: 60  LAEKLAQEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFAL 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  ++ +  S  R+       +  DL   ++K ++        ++  L++ M     +  
Sbjct: 120 TLRSRSVYSSRDRVGKLGADFNYADLAKPEFKGKICTRSGKHPYNVSLVSAMIAHNGEAD 179

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 180 TKEWLEGVKAN 190


>gi|145297720|ref|YP_001140561.1| ABC-type iron(III) transporter, periplasmic component [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142850492|gb|ABO88813.1| ABC-type iron(III) transporter, periplasmic component [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 336

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 85/185 (45%), Gaps = 8/185 (4%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRPPIT 69
           +L L   T A         + +Y+++   ++ PII  FE+ +G+K++ ++        + 
Sbjct: 6   MLALAFSTLAAQGALAAGEVNVYSNRQDELIKPIIQQFEKESGIKVNVVFAKEGLNERLE 65

Query: 70  -QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQV 123
            +G  SP D+++T D + L   +++ L+  + + ++ +    + ++   +   ++   + 
Sbjct: 66  REGKLSPADLMLTVDISRLTDLVDKGLVQPVDSKILQENIPSIYRDPENRWFALTTRVRA 125

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIK 182
           +  S +R+   D  +   DL   ++K ++        ++  L+++M         + +++
Sbjct: 126 IYSSKERLGKLDTIR-YEDLVKPEFKGKICTRSGKHEYNVALVSSMIAHHGMADAKTWLE 184

Query: 183 NITAN 187
            + AN
Sbjct: 185 GVKAN 189


>gi|114046116|ref|YP_736666.1| extracellular solute-binding protein [Shewanella sp. MR-7]
 gi|113887558|gb|ABI41609.1| extracellular solute-binding protein, family 1 [Shewanella sp.
           MR-7]
          Length = 335

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 81/184 (44%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             L G     ++ +  + LT+Y+ +   ++ PI+  F E TG+ ++ ++    I      
Sbjct: 7   AALLGLMSVANSASADETLTVYSYRQPFLVEPILKRFTEETGIGVNFVFAKDGIAERIAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   +++DL   + +  +        ++ + +   ++   + L
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVDKDLTSSVKSEQLNSNIPAQYRDPDGQWYALTMRVRNL 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +  S  +L + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YTAKDRLGPQAI--SYEELADPKYKGKICTRSGKHPYNIALVASMIAHHGEADTKTWLQG 184

Query: 184 ITAN 187
           +  N
Sbjct: 185 VKTN 188


>gi|59712758|ref|YP_205534.1| iron(III) ABC transporter, periplasmic binding protein [Vibrio
           fischeri ES114]
 gi|59480859|gb|AAW86646.1| iron(III) ABC transporter, periplasmic binding protein [Vibrio
           fischeri ES114]
          Length = 337

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT- 60
            K+ +    L+   F     +    + + +Y+ +   ++ P+   F + TG++++  +  
Sbjct: 1   MKKLLSVSALIAGMFAP---SVMAAEEVNVYSYRQPFLVEPMFKEFTKETGIQVNVKFAK 57

Query: 61  SSIQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLM 115
             +      +G  SP DVI+T D + LA   N++L+  + + +I        ++   +  
Sbjct: 58  KGLAEKLAQEGELSPADVILTTDISRLAELTNKNLVQPVDSKVIDANVPAQYRDAEDEWF 117

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNK 174
            ++   + +  S  R+          DL   +WK ++        ++  L+++M     +
Sbjct: 118 ALTLRARNVYSSRDRVGKLGADFDYADLAKPEWKGKICTRSGKHPYNVSLVSSMIAHHGE 177

Query: 175 TVVQDFIKNITAN 187
              + +++ + +N
Sbjct: 178 AEAKTWLEGVKSN 190


>gi|99079965|ref|YP_612119.1| extracellular solute-binding protein [Ruegeria sp. TM1040]
 gi|99036245|gb|ABF62857.1| extracellular solute-binding protein family 1 [Ruegeria sp. TM1040]
          Length = 336

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 84/194 (43%), Gaps = 14/194 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
            K  ++T ++     T A +       + LY+ ++      +   FEE TG+ I+ I   
Sbjct: 1   MKIKVFTTVIAASLATTAVA----DGVVNLYSSRHYDTDERLYTDFEEATGITINRIEGK 56

Query: 62  SIQR----PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKL 114
           + +           SP DV+IT D + L  A N  +L  + + +++ +    L++ + + 
Sbjct: 57  ADELVARMQAEGANSPADVLITVDTSRLERAKNAGVLQSIDSDILEERIPANLQDSDNQW 116

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLS-IAPNNISFHRLLNTMEQTPN 173
              S   +++ Y    +  A+ P    DL   ++K  +   + +N+    LL+ + +   
Sbjct: 117 FGFSQRARIVFYDKTDV--ANPPADYMDLAKPEYKGMVCHRSSSNVYSQTLLSAIIENHG 174

Query: 174 KTVVQDFIKNITAN 187
           +   +D+ + I AN
Sbjct: 175 EEAARDWAEGIVAN 188


>gi|254466777|ref|ZP_05080188.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
 gi|206687685|gb|EDZ48167.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
          Length = 338

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 83/189 (43%), Gaps = 10/189 (5%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR- 65
            T +L         +T      L +Y+ ++      +   FEE TG+ I+ I  ++ +  
Sbjct: 4   ATTVLAGALTAAIATTAAAEGELNIYSSRHYDTDEQLYSEFEEATGITINRIEGNADELI 63

Query: 66  ---PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLIK-KNSFVLKNENKKLMRISF 119
                  + SP D++IT D + L  A +  +L  + + +++ +    L++E+ +    S 
Sbjct: 64  ARMTAEGENSPADILITVDTSRLTRAKDAGVLQSIESDVLEARVPGYLQDEDNQWFGFSQ 123

Query: 120 DTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNKTVVQ 178
             +++ Y+   +  A+ P +  DL +  +K ++ I  + N     LL ++         +
Sbjct: 124 RARIIFYNKDAV--ANPPLTYLDLADPAYKGKVCIRSSKNTYNQTLLASIVTHHGADAAR 181

Query: 179 DFIKNITAN 187
           ++ + + AN
Sbjct: 182 NWAEGVVAN 190


>gi|312963750|ref|ZP_07778221.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311281785|gb|EFQ60395.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 334

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 72/177 (40%), Gaps = 9/177 (5%)

Query: 19  AFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPV 74
             +T      + +Y+ +   ++ P+  ++ ++TGV++  I               + +  
Sbjct: 17  GSTTVQAADEVVVYSSRIDELIKPVFDAYTKKTGVQVKFITDKEAPLMQRIKAEGENATA 76

Query: 75  DVIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRI 131
           D+++T D  +L   E   +L    + +I K      ++       +S   + +AYST R+
Sbjct: 77  DLLLTVDAGNLWQAEQMGILQPFTSAVIDKNIPLQYRSSAHAWTGLSLRARTIAYSTDRV 136

Query: 132 KIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
           K  DL  +   L + QW+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 KPGDL-TTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAAKTEAIVKGWVNN 192


>gi|269961946|ref|ZP_06176301.1| Iron-utilization periplasmic protein [Vibrio harveyi 1DA3]
 gi|269833269|gb|EEZ87373.1| Iron-utilization periplasmic protein [Vibrio harveyi 1DA3]
          Length = 337

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 83/186 (44%), Gaps = 7/186 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++  +    +    
Sbjct: 5   LTLSAITCATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKGLAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   ++  T+
Sbjct: 65  AQEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRTR 124

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFI 181
            +  S  R+       +  DL   ++K ++        ++  L+++M     +   ++++
Sbjct: 125 NVYSSRDRVGKLGNDFNYADLAKPEFKGKICTRSGKHPYNVSLVSSMIAHHGEAETKEWL 184

Query: 182 KNITAN 187
           + + AN
Sbjct: 185 EGVKAN 190


>gi|168204381|ref|ZP_02630386.1| iron compound ABC transporter, iron compound-binding protein
           [Clostridium perfringens E str. JGS1987]
 gi|170664038|gb|EDT16721.1| iron compound ABC transporter, iron compound-binding protein
           [Clostridium perfringens E str. JGS1987]
          Length = 350

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 89/199 (44%), Gaps = 15/199 (7%)

Query: 6   IYTYLLLLCGF----TEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
           +   +L  CG     T+A +TE+  K + +Y+ ++  +   +   FE  TG+K++ +   
Sbjct: 16  VSMGVLAGCGQKNQETKAEATESGEKVVNVYSSRHYDIDKQLFKDFESDTGIKVNLVDGK 75

Query: 62  SIQR----PPITQGSPVDVIITKDETSLAL--NEDLLHKLPAH-LIKKNSFVLKNENKKL 114
           S +           +  DV +T    ++A    +DL+  + +  + +      +   K  
Sbjct: 76  SDELIERMAREGDNTSADVFLTVGAENIAQLNEKDLIKDISSEKINENIPSEYRG--KNW 133

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPN 173
           + ++   +++ Y+ +++    + K+  DLT  ++K ++    ++ S+ + LL++  Q   
Sbjct: 134 VGLTSRARIIVYNKEKVNPETI-KTYNDLTKDEFKGKVLTRSSSSSYNNALLSSFIQLDG 192

Query: 174 KTVVQDFIKNITANEILTK 192
               +++ + I  N   T 
Sbjct: 193 AEKAKEWAQGIVNNFARTP 211


>gi|156975700|ref|YP_001446607.1| hypothetical protein VIBHAR_03435 [Vibrio harveyi ATCC BAA-1116]
 gi|156527294|gb|ABU72380.1| hypothetical protein VIBHAR_03435 [Vibrio harveyi ATCC BAA-1116]
          Length = 337

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 83/186 (44%), Gaps = 7/186 (3%)

Query: 9   YLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPP 67
             L          T    + + +Y+ +   ++ P+ + F + TG+K++  +    +    
Sbjct: 5   LTLSAITCATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKGLAEKL 64

Query: 68  ITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQ 122
             +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   ++  T+
Sbjct: 65  AQEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRTR 124

Query: 123 VLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFI 181
            +  S  R+       +  DL   ++K ++        ++  L+++M     +   ++++
Sbjct: 125 NVYSSRDRVGKLGNDFNYADLAKPEFKGKICTRSGKHPYNVSLVSSMIAHHGEAETKEWL 184

Query: 182 KNITAN 187
           + + AN
Sbjct: 185 EGVKAN 190


>gi|126462325|ref|YP_001043439.1| extracellular solute-binding protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639329|ref|YP_002525591.1| family 1 extracellular solute-binding protein [Rhodobacter
           sphaeroides KD131]
 gi|332558347|ref|ZP_08412669.1| Extracellular solute-binding protein, family 1 precursor
           [Rhodobacter sphaeroides WS8N]
 gi|126103989|gb|ABN76667.1| extracellular solute-binding protein, family 1 [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221160110|gb|ACM01090.1| Extracellular solute-binding protein, family 1 precursor
           [Rhodobacter sphaeroides KD131]
 gi|332276059|gb|EGJ21374.1| Extracellular solute-binding protein, family 1 precursor
           [Rhodobacter sphaeroides WS8N]
          Length = 336

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 71/169 (42%), Gaps = 8/169 (4%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPITQG--SPVDVIITKDE 82
              + +Y+ +   ++ P++ +F   TG+ ++  +    +    + +G  SP D+++T D 
Sbjct: 22  ADEVNIYSHRQPELIQPLVDAFTAETGIDVNVAFVDKGMAERLVAEGNRSPADLVLTVDI 81

Query: 83  TSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             L   +   +   + + ++        ++       ++   +++  S +R+K  ++  +
Sbjct: 82  ARLMQVVEAGVTQPVESDVLSSNIPAEFRDPAGHWFGLTSRARIVYASKERVKDGEV-TT 140

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + +WK R+        ++  L   +         + +++ + AN
Sbjct: 141 YEDLASDKWKGRICTRSFTSDYNVALTGAVIAHHGTEGAKTWLEGVKAN 189


>gi|77463470|ref|YP_352974.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacter sphaeroides 2.4.1]
 gi|77387888|gb|ABA79073.1| ABC Fe+3 siderophore transporter, periplasmic substrate-binding
           protein [Rhodobacter sphaeroides 2.4.1]
          Length = 336

 Score =  139 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 71/169 (42%), Gaps = 8/169 (4%)

Query: 26  TKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-TSSIQRPPITQG--SPVDVIITKDE 82
              + +Y+ +   ++ P++ +F   TG+ ++  +    +    + +G  SP D+++T D 
Sbjct: 22  ADEVNIYSHRQPELIQPLVDAFTAETGIDVNVAFVDKGMAERLVAEGNRSPADLVLTVDI 81

Query: 83  TSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS 139
             L   +   +   + + ++        ++       ++   +++  S +R+K  ++  +
Sbjct: 82  ARLMQVVEAGVTQPVESDVLSSNIPAEFRDPAGHWFGLTSRARIVYASKERVKDGEV-TT 140

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL + +WK R+        ++  L   +         + +++ + AN
Sbjct: 141 YEDLASDKWKGRICTRSFTSDYNVALTGAVIAHHGTEGAKTWLEGVKAN 189


>gi|254360752|ref|ZP_04976900.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
 gi|153091322|gb|EDN73296.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
          Length = 318

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 81/169 (47%), Gaps = 11/169 (6%)

Query: 28  YLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS-SIQRPPITQG--SPVDVIITKDETS 84
            + +Y+ +   ++ P++ +FE+ TG+K++ I+    +      +G  SP DV++T D + 
Sbjct: 1   EVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISR 60

Query: 85  LA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKS-- 139
           +   +N DL  K+ + +++K      ++ N +   ++   +V+  S  R+    LP    
Sbjct: 61  VMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRV--GKLPAGFD 118

Query: 140 VFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKNITAN 187
             DL   ++K ++ +     S++  L   M +       + F++ + AN
Sbjct: 119 YLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN 167


>gi|331014844|gb|EGH94900.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 333

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 69/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            S       + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSAAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|170725358|ref|YP_001759384.1| extracellular solute-binding protein [Shewanella woodyi ATCC 51908]
 gi|169810705|gb|ACA85289.1| extracellular solute-binding protein family 1 [Shewanella woodyi
           ATCC 51908]
          Length = 335

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 83/184 (45%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           L + G     S  N    LT+Y+ +   ++ PI++ F + TG+ +  +++   I    + 
Sbjct: 7   LAVLGLVCFASVANAADKLTVYSYRQAFLIDPILNDFTKETGIDVDVVFSKKGIAERMMR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP DV++T D   L   ++++L+    + L+        ++ ++    ++   + +
Sbjct: 67  EGRLSPADVVLTSDFYRLMELVDKELVVPASSELLNSNIPAQYRSPDETWYALTMRVRNI 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S +R+    L  +  DL + ++K ++        ++  L+ +M     +   + ++  
Sbjct: 127 YSSKERL--GKLNINYEDLADPKYKGKICTRSGKHPYNISLVASMIAHHGEAETKAWLTG 184

Query: 184 ITAN 187
           + AN
Sbjct: 185 LKAN 188


>gi|304322243|ref|YP_003855886.1| iron binding protein component of ABC iron transporter
           [Parvularcula bermudensis HTCC2503]
 gi|303301145|gb|ADM10744.1| iron binding protein component of ABC iron transporter
           [Parvularcula bermudensis HTCC2503]
          Length = 356

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 81/187 (43%), Gaps = 14/187 (7%)

Query: 14  CGFTEAFSTEN-----TTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR--- 65
           CG  +  S+++         + +Y+ ++    L + + F E+TG++++ I  S+      
Sbjct: 26  CGGGDTSSSDSPTAAMEAGVVNIYSSRHYDTDLALYNDFTEQTGIRVNRIEASADALIER 85

Query: 66  -PPITQGSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDT 121
                + SP D++IT D   L  A    +L    + L+  +    L++       +S   
Sbjct: 86  ISAEGEFSPADILITVDAGRLWRAEEAGVLSATRSALLEDRIPANLRHPEGLWFGVSKRA 145

Query: 122 QVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDF 180
           +V+ Y+ +  K   L  +  DL +   K ++ + + +NI    LL ++     +   Q +
Sbjct: 146 RVIIYNKENGKPEPLE-TYEDLADPAHKGKICMRSSSNIYNISLLASIIANDGEDAAQAW 204

Query: 181 IKNITAN 187
            K + AN
Sbjct: 205 AKGVVAN 211


>gi|254230613|ref|ZP_04923971.1| bacterial extracellular solute-binding protein, putative [Vibrio
           sp. Ex25]
 gi|151936861|gb|EDN55761.1| bacterial extracellular solute-binding protein, putative [Vibrio
           sp. Ex25]
          Length = 332

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 82/185 (44%), Gaps = 7/185 (3%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPI 68
            L          T    + + +Y+ +   ++ P+ + F + TG+K++  +    +     
Sbjct: 1   TLSALTCATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKKGLAEKLA 60

Query: 69  TQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQV 123
            +G  SP DVI+T D + LA   N+ L+ K+ + +I++      +++  +   ++  ++ 
Sbjct: 61  QEGEYSPADVILTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFALTLRSRS 120

Query: 124 LAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIK 182
           +  S  R+       +  DL   ++K ++        ++  L++ M     +   +++++
Sbjct: 121 VYSSRDRVGKLGADFNYADLAKPEFKGKICTRSGKHPYNVSLVSAMIAHNGEADTKEWLE 180

Query: 183 NITAN 187
            + AN
Sbjct: 181 GVKAN 185


>gi|89052609|ref|YP_508060.1| extracellular solute-binding protein [Jannaschia sp. CCS1]
 gi|88862158|gb|ABD53035.1| extracellular solute-binding protein family 1 [Jannaschia sp. CCS1]
          Length = 339

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/194 (17%), Positives = 80/194 (41%), Gaps = 12/194 (6%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTS 61
             RT+   L      + A +     + L LY+ ++      +   F + TG+ I+ I  +
Sbjct: 1   MTRTLTALLGTTIFMSTALAA--QAQELNLYSSRHYETDERLYSDFTDLTGITINRIEGN 58

Query: 62  SIQRPPITQ----GSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKKL 114
           + +     +     SP DV +T D + L  A +  LL  + + ++ ++    L++++   
Sbjct: 59  ADELIARMEAEGANSPADVFLTVDTSRLQRAADAGLLQTVDSEVLAERIPANLRDDDGLW 118

Query: 115 MRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLS-IAPNNISFHRLLNTMEQTPN 173
              S   +++ Y T  +     P++  DL +  ++  +   +  N+    LL+ + +   
Sbjct: 119 FGFSQRARIIFYDTADV--ETPPQTYVDLADPAYEGMVCHRSSTNVYSQTLLSAVIENYG 176

Query: 174 KTVVQDFIKNITAN 187
           +   +++      N
Sbjct: 177 EEAAREWAAGFVNN 190


>gi|163750123|ref|ZP_02157366.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella benthica KT99]
 gi|161330180|gb|EDQ01162.1| iron(III) ABC transporter, periplasmic iron(III)-binding protein
           [Shewanella benthica KT99]
          Length = 329

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 84/184 (45%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           + + G     S  N  + LT+Y+ +   ++ PI+ +F + TG+ +  +++   I    + 
Sbjct: 1   MAILGLVCFASAANAAENLTVYSYRQAFLVRPILANFTKETGIDVDVVFSKKGIAERMMR 60

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   ++++L+  + + L+K       ++       ++   + +
Sbjct: 61  EGRLSPADIVLTSDFSRLMELVDKNLVIPVDSELLKANIPAKYRSREDNWYALTMRVRNI 120

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S  R+   D+     DL + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 121 YSSKDRLGKLDI--DYEDLADPKYKGKICTRSGKHPYNISLVASMIAHHGEADTKTWLEG 178

Query: 184 ITAN 187
             AN
Sbjct: 179 WKAN 182


>gi|160876921|ref|YP_001556237.1| extracellular solute-binding protein [Shewanella baltica OS195]
 gi|160862443|gb|ABX50977.1| extracellular solute-binding protein family 1 [Shewanella baltica
           OS195]
 gi|315269125|gb|ADT95978.1| extracellular solute-binding protein family 1 [Shewanella baltica
           OS678]
          Length = 335

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 79/184 (42%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             + G      + N    LT+Y+ +   ++ PI+  F E TG+ ++ ++    I      
Sbjct: 7   AAVVGLMSVGHSANADDKLTVYSYRQAFLVEPILTRFTEETGIGVNLVFAKDGIAERLAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   +++DL   +    ++       ++ + +   ++   + L
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVDKDLTSPVKNTQLESNIPAQYRDPDGQWYALTMRVRNL 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +  +  +L + ++K ++        ++  L+ +M     +   + ++  
Sbjct: 127 YTAKDRLGPQQI--TYEELADPKYKGKICTRSGKHPYNIALVASMIAHHGEAETKTWLAG 184

Query: 184 ITAN 187
           + +N
Sbjct: 185 VKSN 188


>gi|330972176|gb|EGH72242.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 333

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 71/176 (40%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++   TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++ +     +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSSHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            A+L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PAEL-STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|330874530|gb|EGH08679.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 333

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            S       + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSAAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   LT+  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALTDKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|257481787|ref|ZP_05635828.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|331009421|gb|EGH89477.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 333

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILRPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|254474669|ref|ZP_05088055.1| extracellular solute-binding protein, family 1 [Ruegeria sp. R11]
 gi|214028912|gb|EEB69747.1| extracellular solute-binding protein, family 1 [Ruegeria sp. R11]
          Length = 338

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 82/188 (43%), Gaps = 10/188 (5%)

Query: 8   TYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR-- 65
           T +L         +T      L LY+ ++      +   FEE TG+ I+ I   + +   
Sbjct: 5   TTILAGALTAAVATTAAAEGELNLYSSRHYDTDERLYTDFEEATGITINRIEGKADELIA 64

Query: 66  --PPITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFD 120
                 + SP DV++T D + LA   N  +L  + +  + ++    L++ + +    S  
Sbjct: 65  RMQAEGENSPADVLLTVDTSRLARAKNAGVLQSIESATLEERIPANLQDNDNQWFGFSQR 124

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLS-IAPNNISFHRLLNTMEQTPNKTVVQD 179
            +++   T  +  A+ P++  DL   ++K  +   + +N+    LL+++ +   +   ++
Sbjct: 125 ARIIFVDTDEV--ANPPQTYLDLAKPEYKGMVCHRSSSNVYSQTLLSSIIENHGEEAARE 182

Query: 180 FIKNITAN 187
           +   + AN
Sbjct: 183 WAAGMVAN 190


>gi|289624826|ref|ZP_06457780.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289647727|ref|ZP_06479070.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298484850|ref|ZP_07002950.1| Ferric iron ABC transporter, iron-binding protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298160704|gb|EFI01725.1| Ferric iron ABC transporter, iron-binding protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|330866557|gb|EGH01266.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 333

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|28867545|ref|NP_790164.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213971654|ref|ZP_03399762.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato T1]
 gi|301385623|ref|ZP_07234041.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato Max13]
 gi|302061509|ref|ZP_07253050.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato K40]
 gi|302134611|ref|ZP_07260601.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28850780|gb|AAO53859.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213923610|gb|EEB57197.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. tomato T1]
          Length = 333

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 69/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            S       + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSAAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|330986838|gb|EGH84941.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 333

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|71735687|ref|YP_272537.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|71556240|gb|AAZ35451.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 333

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 71/176 (40%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST   T  + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTVQATDEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGTEASEKILKGWVNN 191


>gi|330943302|gb|EGH45687.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 333

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++   TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTASTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
            A+L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PAEL-STYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|313675764|ref|YP_004053760.1| extracellular solute-binding protein family 1 [Marivirga tractuosa
           DSM 4126]
 gi|312942462|gb|ADR21652.1| extracellular solute-binding protein family 1 [Marivirga tractuosa
           DSM 4126]
          Length = 372

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 74/167 (44%), Gaps = 9/167 (5%)

Query: 29  LTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----PPITQGSPVDVIITKDETS 84
           + +YT ++      +   FEE+TG+K++ +  ++ +         + SP DV+IT D   
Sbjct: 59  VNVYTHRHYESDQQLFKDFEEKTGIKVNVVSANADELIQKMTLEGENSPADVLITVDAGR 118

Query: 85  L--ALNEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVF 141
           L  A   DLL  + +  +    S  L++ + +   ++   +V+ Y+ ++I    +  +  
Sbjct: 119 LHRAKEADLLQSVESETLNNTISSNLRDVDNQWFGLTIRGRVIVYNPEKISAEKI-STYE 177

Query: 142 DLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKNITAN 187
            L N     RL I + +NI    L+ ++     +     +  +I  N
Sbjct: 178 SLANPDINGRLLIRSSSNIYNQSLMASIIAHNGEEAASTWASSIVNN 224


>gi|15601916|ref|NP_244988.1| FbpA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720256|gb|AAK02135.1| FbpA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 355

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 83/196 (42%), Gaps = 15/196 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M K +     L     T A +       + +Y+ +   ++ P++  FE+ TGVK++ I+ 
Sbjct: 19  MKKISTLALALSAVISTSAMAAN----EVNVYSYRQPYLIEPMLKDFEKDTGVKVNVIFA 74

Query: 61  SS---IQRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKL 114
                 +     + SP DV++T D + +   + E L   + +  ++K      ++   + 
Sbjct: 75  DKGLVDRVKREGELSPADVLLTVDISRVMEIVKEGLAQPIHSETLEKNIPAQFRDSKDEW 134

Query: 115 MRISFDTQVLAYSTKRIKIADLPK--SVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQT 171
             ++   + +  +  R+    LP   + +DL   ++K ++ +    N     L+ +M   
Sbjct: 135 FALTTRARAIYTAKDRV--GKLPADFTYYDLAKPEYKGKVCVRSGKNAYNVSLVASMIAH 192

Query: 172 PNKTVVQDFIKNITAN 187
             +   + F++ + AN
Sbjct: 193 DGEAKAKAFLEGLKAN 208


>gi|320322210|gb|EFW78306.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320331874|gb|EFW87812.1| iron ABC transporter, periplasmic iron-binding protein [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330873070|gb|EGH07219.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 333

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTVQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|167622837|ref|YP_001673131.1| extracellular solute-binding protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167352859|gb|ABZ75472.1| extracellular solute-binding protein family 1 [Shewanella
           halifaxensis HAW-EB4]
          Length = 335

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 85/184 (46%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT-SSIQRPPIT 69
           L + G T   S  N    LT+Y+ +   ++ PI+ +F + TG+K+  +++   I    + 
Sbjct: 7   LAVIGLTCFASIANAADSLTVYSYRQAFLIEPILENFTKETGIKVDVVFSKKGIAERMMR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  S  D+++T D   L   + +DL+    + ++K+      ++ + +   ++   + +
Sbjct: 67  EGRLSKADIVLTSDFYRLMELVEKDLVVPASSDILKQNIPEKYRSPDDEWYALTMRVRNV 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             S  R+   D+  +  DL + ++K ++        ++  L+ +M     +   + +++ 
Sbjct: 127 YSSKDRLGKLDI--NYEDLADPKYKGKICTRSGKHPYNVSLVASMIAHHGEQETKTWLEG 184

Query: 184 ITAN 187
             AN
Sbjct: 185 WKAN 188


>gi|153002200|ref|YP_001367881.1| extracellular solute-binding protein [Shewanella baltica OS185]
 gi|151366818|gb|ABS09818.1| extracellular solute-binding protein family 1 [Shewanella baltica
           OS185]
          Length = 335

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 79/184 (42%), Gaps = 9/184 (4%)

Query: 11  LLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQRPPIT 69
             + G      + N    LT+Y+ +   ++ PI+  F E TG+ ++ ++    I      
Sbjct: 7   AAVVGLMSVGHSANADDKLTVYSYRQAFLVEPILTRFTEETGIGVNLVFAKDGIAERLAR 66

Query: 70  QG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVL 124
           +G  SP D+++T D + L   +++DL   +    ++       ++ + +   ++   + L
Sbjct: 67  EGRLSPADLVLTSDFSRLVELVDKDLTSPVKNAQLESNIPAQYRDPDGEWYALTMRVRNL 126

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQDFIKN 183
             +  R+    +  +  +L + ++K ++        ++  L+ +M     +   + ++  
Sbjct: 127 YTAKDRLGPQQI--TYEELADPKYKGKICTRSGKHPYNIALVASMIAQHGEAEAKTWLAG 184

Query: 184 ITAN 187
           + +N
Sbjct: 185 VKSN 188


>gi|56698111|ref|YP_168483.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
 gi|56679848|gb|AAV96514.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
          Length = 349

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 74/184 (40%), Gaps = 10/184 (5%)

Query: 12  LLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQR----PP 67
                    ++      L LY+ ++      +   FEE TG++I+ I   + +       
Sbjct: 20  TAIALALIATSAIAEGELNLYSSRHYDTDERLYTDFEEATGIRINRIEGKADELIARMQA 79

Query: 68  ITQGSPVDVIITKDETSLAL--NEDLLHKLPAHLI-KKNSFVLKNENKKLMRISFDTQVL 124
               SP DV++T D + LA      LL  + + ++  +    L++ + +    S   ++ 
Sbjct: 80  EGANSPADVLLTVDTSRLARAKEAGLLQAIDSAVLEDRIPANLQDSDNQWFGFSQRARLY 139

Query: 125 AYSTKRIKIADLPKSVFDLTNAQWKKRLSI-APNNISFHRLLNTMEQTPNKTVVQDFIKN 183
            Y    +     P +  DL +  +K ++ I +  N     LL  +     + V +D+ ++
Sbjct: 140 FYDKAGVSA--PPATYLDLADPAYKGQVCIRSSTNTYNQTLLAAIITHHGEDVARDWAES 197

Query: 184 ITAN 187
           + AN
Sbjct: 198 VVAN 201


>gi|254454365|ref|ZP_05067802.1| extracellular solute-binding protein, family 1 [Octadecabacter
           antarcticus 238]
 gi|198268771|gb|EDY93041.1| extracellular solute-binding protein, family 1 [Octadecabacter
           antarcticus 238]
          Length = 338

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/195 (21%), Positives = 87/195 (44%), Gaps = 14/195 (7%)

Query: 1   MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYT 60
           M  RTI    LLLC    AF+       L LY+ ++      +  +FE+ TG+KI+ I  
Sbjct: 1   MTTRTITLATLLLCTAAPAFA----DGELNLYSSRHYDTDERLYSNFEDATGIKINRIEG 56

Query: 61  SSIQRPPITQ----GSPVDVIITKDETSL--ALNEDLLHKLPAHLI-KKNSFVLKNENKK 113
           ++ +     +     SP DV++T D + L  A N  +L  + + ++  +    L++ + +
Sbjct: 57  NADELIARMEAEGVNSPADVLLTVDTSRLERAKNAAVLQSIDSEILEDRIPANLQDSDNQ 116

Query: 114 LMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLS-IAPNNISFHRLLNTMEQTP 172
               S   +++ Y+   +   + P +   L +  ++  +   +  N+    LL ++ +  
Sbjct: 117 WYGFSQRARIIFYNKTNV--ENPPMTYIALADPAYEGLVCHRSSTNVYSQTLLASVIENH 174

Query: 173 NKTVVQDFIKNITAN 187
            +   +D+ + I  N
Sbjct: 175 GEAAARDWAQGIVNN 189


>gi|330965680|gb|EGH65940.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 333

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 68/176 (38%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            S       + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSAAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + + YST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPQQYRSSTHGWTGLSLRARTIVYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTATLIETHGAEASEKILKGWVNN 191


>gi|300825510|ref|ZP_07105574.1| bacterial extracellular solute-binding protein [Escherichia coli MS
           119-7]
 gi|300522033|gb|EFK43102.1| bacterial extracellular solute-binding protein [Escherichia coli MS
           119-7]
          Length = 324

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 82/193 (42%), Gaps = 15/193 (7%)

Query: 2   FKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIY-- 59
           FKRT+     L   F            +TLYT +   ++ P++ S+ + +G+ ++ +Y  
Sbjct: 14  FKRTVIPATFLFASFPAFSQD-----IVTLYTTREPGLIKPLLDSWTKSSGINVNTVYIK 68

Query: 60  TSSIQRPPIT-QGSPVDVIITKDETSLA--LNEDLLHKLPAHLIK-KNSFVLKNENKKLM 115
              ++R     + SP D+++T D  +L   +   +   + + ++K      L+ EN    
Sbjct: 69  DGMLERIKAEGKNSPADLLMTVDAGNLIDLVEAGVTQPVESEILKTAIPANLRGENNHWF 128

Query: 116 RISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPN-NISFHRLLNTMEQTPNK 174
            +S   +VL Y+ K   I  L      L + ++K R+ +    +     L+  M     +
Sbjct: 129 ALSMRARVL-YAEKNFPIDSL--HYEQLASPEYKGRVCMRSGQHPYNTALIAAMIAHHGE 185

Query: 175 TVVQDFIKNITAN 187
              ++++  +  N
Sbjct: 186 EKAEEWLHGLKTN 198


>gi|28899265|ref|NP_798870.1| iron(III) ABC transporter periplasmic iron-compound-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|260879039|ref|ZP_05891394.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260895914|ref|ZP_05904410.1| iron(III) dicitrate ABC transporter, ATP-binding protein FecE
           [Vibrio parahaemolyticus Peru-466]
 gi|28807489|dbj|BAC60754.1| iron(III) ABC transporter, periplasmic iron-compound-binding
           protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085375|gb|EFO35070.1| iron(III) dicitrate ABC transporter, ATP-binding protein FecE
           [Vibrio parahaemolyticus Peru-466]
 gi|308089574|gb|EFO39269.1| iron ABC transporter, iron-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|328474198|gb|EGF45003.1| iron(III) ABC transporter periplasmic iron-compound-binding protein
           [Vibrio parahaemolyticus 10329]
          Length = 337

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 87/191 (45%), Gaps = 9/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           + + T   L C       T    + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 2   KKLLTLSALTCATLA--PTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKEG 59

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DV++T D + LA   N+ L+ K+ + +I++      +++  +   +
Sbjct: 60  LAEKLAQEGEYSPADVVLTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFAL 119

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  T+ +  S  R+       +  DL   ++K ++        ++  L+++M     +  
Sbjct: 120 TLRTRSVYSSRDRVGKLGADFNYADLAKPEYKGKICTRSGKHPYNVSLVSSMIAHYGEAE 179

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 180 TKEWLEGVKAN 190


>gi|83592108|ref|YP_425860.1| extracellular solute-binding protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83575022|gb|ABC21573.1| extracellular solute-binding protein, family 1 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 347

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 79/191 (41%), Gaps = 8/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSI 63
           R     + LL G T           + +Y+ +   ++ P++  F   TGV+ + ++T   
Sbjct: 7   RLFPVLISLLAGSTSLAGPAMAEGEVNIYSYRQPFLIQPMLDRFTAETGVRTNVVFTDQG 66

Query: 64  ---QRPPITQGSPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
              +       SP DV++T D + L   +   ++  + + +I+       ++   +   +
Sbjct: 67  LVERLKAEGANSPADVVLTVDISRLNELVTAKVVRPVSSPVIEANIPAATRDPQGRWFGL 126

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +   + +  +  R+    +  S  DL + +WK R+   P +  ++  L++ M        
Sbjct: 127 TTRARAIFAAKDRVPAGAV-TSYADLADPRWKGRVCSRPGDHVYNIGLISAMIAHDGVDK 185

Query: 177 VQDFIKNITAN 187
            + +++ + AN
Sbjct: 186 TKAWLEGVKAN 196


>gi|51892295|ref|YP_074986.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855984|dbj|BAD40142.1| iron ABC transporter substrate-binding protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 356

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 88/214 (41%), Gaps = 26/214 (12%)

Query: 5   TIYTYLLLLCGFTEAFSTE------------------NTTKYLTLYTDQNQSVMLPIIHS 46
           ++   +L  CG ++   +                      K + +YT     +  P+  +
Sbjct: 13  SLCALVLSACGGSQQPPSNQPPSGGGQQQQQQEPQGSAEPKEIVVYTSHQADIHEPLFKA 72

Query: 47  FEERTGVKISPIYTSS---IQRPPITQGSPV-DVIITKDETSLALNEDLLHKLPAHLIKK 102
           FEE TG+K++P+Y ++    QR      +P+ DVI      +   N+DLL       I K
Sbjct: 73  FEEATGIKVTPVYAATGELFQRMRAEANNPLGDVIFGGGAETHEANKDLLQPYVPKEIDK 132

Query: 103 NSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSI--APNNIS 160
            +     ++      +    V+ Y+T  +   + PKS  DLT+ +W  ++++  A  + S
Sbjct: 133 LAPGTVAKDNSWTGFTALPIVIMYNTNLLTADEAPKSFADLTDPKWAGKIAMPDAAKSGS 192

Query: 161 FHRLLNTMEQTPNKTVVQDF--IKNITANEILTK 192
            +  + T+     +   + +  +K I AN  +  
Sbjct: 193 AYTTVVTILHAMGRDDGKGWEVMKQIAANAKILA 226


>gi|153838407|ref|ZP_01991074.1| iron binding protein FbpA [Vibrio parahaemolyticus AQ3810]
 gi|149748214|gb|EDM59073.1| iron binding protein FbpA [Vibrio parahaemolyticus AQ3810]
          Length = 336

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 87/191 (45%), Gaps = 9/191 (4%)

Query: 4   RTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS- 62
           + + T   L C       T    + + +Y+ +   ++ P+ + F + TG+K++  +    
Sbjct: 1   KKLLTLSALTCATLA--PTAMAAEEVNVYSYRQPFLVEPMFNEFTKETGIKVNVKFAKEG 58

Query: 63  IQRPPITQG--SPVDVIITKDETSLA--LNEDLLHKLPAHLIKK-NSFVLKNENKKLMRI 117
           +      +G  SP DV++T D + LA   N+ L+ K+ + +I++      +++  +   +
Sbjct: 59  LAEKLAQEGEYSPADVVLTTDISRLAELTNKGLVQKVDSKIIEENVPAQYQDKENEWFAL 118

Query: 118 SFDTQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTV 176
           +  T+ +  S  R+       +  DL   ++K ++        ++  L+++M     +  
Sbjct: 119 TLRTRSVYSSRDRVGKLGADFNYADLAKPEYKGKICTRSGKHPYNVSLVSSMIAHYGEAE 178

Query: 177 VQDFIKNITAN 187
            +++++ + AN
Sbjct: 179 TKEWLEGVKAN 189


>gi|330890957|gb|EGH23618.1| iron ABC transporter periplasmic iron-binding protein [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 333

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 9/176 (5%)

Query: 20  FSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQRP----PITQGSPVD 75
            ST      + +Y+ +   ++ P+  ++  +TGVKI  I               + +  D
Sbjct: 17  GSTAQAADEVVVYSSRIDELIKPVFDAYTAKTGVKIKFITDKEAPLMQRIKAEGENATAD 76

Query: 76  VIITKDETSLALNE--DLLHKLPAHLIKK-NSFVLKNENKKLMRISFDTQVLAYSTKRIK 132
           +++T D  +L   E   +L    + +I+       ++       +S   + +AYST R+K
Sbjct: 77  LLLTVDAGNLWQAEQMGILQPFTSPVIEANIPPQYRSSTHGWTGLSLRARTIAYSTDRVK 136

Query: 133 IADLPKSVFDLTNAQWKKRLSIAPNNISF-HRLLNTMEQTPNKTVVQDFIKNITAN 187
             +L  +   L +  W+ RL +      +   L  T+ +T      +  +K    N
Sbjct: 137 PVEL-TTYEALADKNWEGRLCLRTAKKVYNQSLTPTLIETHGAEASEKILKGWVNN 191


>gi|260771209|ref|ZP_05880136.1| ferric iron ABC transporter iron-binding protein [Vibrio furnissii
           CIP 102972]
 gi|260613806|gb|EEX38998.1| ferric iron ABC transporter iron-binding protein [Vibrio furnissii
           CIP 102972]
          Length = 337

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 79/188 (42%), Gaps = 8/188 (4%)

Query: 7   YTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS-IQR 65
              L  L G   A S     + + +Y+ +   ++ P+   F + TG++++  +    I  
Sbjct: 4   LLALSALAGCVMAPSAIAADE-VNVYSYRQPFLIEPMFKEFTQETGIQVNVKFAKEGIAE 62

Query: 66  PPITQG--SPVDVIITKDETSL--ALNEDLLHKLPAHLIKK-NSFVLKNENKKLMRISFD 120
               +G  SP DVI+T + + L    ++ L   + + +I +      ++ +++   ++  
Sbjct: 63  KLAQEGEYSPADVILTSEFSRLFELSDKGLTQPVKSAVIDENIPAQYRDSSEEWFALTIR 122

Query: 121 TQVLAYSTKRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFH-RLLNTMEQTPNKTVVQD 179
           T+ +  S  R+          DL N Q+K ++        ++  L+  M     +   + 
Sbjct: 123 TRSVYSSRDRVGKLGDDFDYLDLANPQYKGKICTRSGKHPYNIALVAAMIANHGEAETKT 182

Query: 180 FIKNITAN 187
           +++ + AN
Sbjct: 183 WLQGVKAN 190


>gi|71083926|ref|YP_266646.1| iron-uptake ABC transport system periplasmic iron-binding protein
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|71063039|gb|AAZ22042.1| probable iron-uptake ABC transport system periplasmic iron-binding
           protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 339

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 79/187 (42%), Gaps = 11/187 (5%)

Query: 10  LLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSS--IQRPP 67
           ++L+      F +      + +++ ++    + + + F  +TG+K++ I      +Q+  
Sbjct: 4   IILIILTLSFFKSMTLANEVNVFSARHYDSDIQLYNKFTSQTGIKVNVISGKDKSLQKRI 63

Query: 68  ITQG--SPVDVIITKDETSLAL--NEDLLHK-LPAHLIKKNSFVLKNENKKLMRISFDTQ 122
           I +G  S  D+ IT D   L L   + +    +   +        ++  K    I+   +
Sbjct: 64  IEEGKDSKADLYITADAGKLGLFDLKGMFQNSMSPAIKSAVPANFRS--KNWTGIAKRAR 121

Query: 123 VLAYSTKRIKIADLPK-SVFDLTNAQWKKRLSIA-PNNISFHRLLNTMEQTPNKTVVQDF 180
           ++ YS +R+   DL   +   L + +WK R+ I   NNI    L+ ++     K     +
Sbjct: 122 IIYYSPERVSDNDLNGLTYEGLADPKWKGRIVIRQSNNIYNQSLVASLIDNNGKERTTIW 181

Query: 181 IKNITAN 187
            +N+  N
Sbjct: 182 AENLVKN 188


>gi|17988929|ref|NP_541562.1| iron(III)-binding periplasmic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|161620757|ref|YP_001594643.1| extracellular solute-binding protein [Brucella canis ATCC 23365]
 gi|163844829|ref|YP_001622484.1| hypothetical protein BSUIS_B0685 [Brucella suis ATCC 23445]
 gi|225686473|ref|YP_002734445.1| family 1 extracellular solute-binding protein [Brucella melitensis
           ATCC 23457]
 gi|254695736|ref|ZP_05157564.1| extracellular solute-binding protein family 1 [Brucella abortus bv.
           3 str. Tulya]
 gi|254699922|ref|ZP_05161750.1| extracellular solute-binding protein family 1 [Brucella suis bv. 5
           str. 513]
 gi|254703044|ref|ZP_05164872.1| extracellular solute-binding protein family 1 [Brucella suis bv. 3
           str. 686]
 gi|254705816|ref|ZP_05167644.1| extracellular solute-binding protein family 1 [Brucella
           pinnipedialis M163/99/10]
 gi|254711044|ref|ZP_05172855.1| extracellular solute-binding protein family 1 [Brucella
           pinnipedialis B2/94]
 gi|254712493|ref|ZP_05174304.1| extracellular solute-binding protein family 1 [Brucella ceti
           M644/93/1]
 gi|254715566|ref|ZP_05177377.1| extracellular solute-binding protein family 1 [Brucella ceti
           M13/05/1]
 gi|256015468|ref|YP_003105477.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein, putative [Brucella microti CCM 4915]
 gi|256029425|ref|ZP_05443039.1| extracellular solute-binding protein family 1 [Brucella
           pinnipedialis M292/94/1]
 gi|256043580|ref|ZP_05446507.1| extracellular solute-binding protein family 1 [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256111383|ref|ZP_05452409.1| extracellular solute-binding protein family 1 [Brucella melitensis
           bv. 3 str. Ether]
 gi|256157618|ref|ZP_05455536.1| extracellular solute-binding protein family 1 [Brucella ceti
           M490/95/1]
 gi|256253407|ref|ZP_05458943.1| extracellular solute-binding protein family 1 [Brucella ceti B1/94]
 gi|256262389|ref|ZP_05464921.1| bacterial extracellular solute-binding protein [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260167484|ref|ZP_05754295.1| iron compound ABC transporter, periplasmic iron compound-binding
           protein, putative [Brucella sp. F5/99]
 gi|260564773|ref|ZP_05835258.1| bacterial extracellular solute-binding protein, family 1 [Brucella
           melitensis bv. 1 str. 16M]
 gi|260568028|ref|ZP_05838497.1| bacterial extracellular solute-binding protein, family 1 [Brucella
           suis bv. 4 str. 40]
 gi|261216145|ref|ZP_05930426.1| extracellular solute-binding protein family 1 [Brucella abortus bv.
           3 str. Tulya]
 gi|261217307|ref|ZP_05931588.1| extracellular solute-binding protein family 1 [Brucella ceti
           M13/05/1]
 gi|261220529|ref|ZP_05934810.1| extracellular solute-binding protein [Brucella ceti B1/94]
 gi|261313239|ref|ZP_05952436.1| extracellular solute-binding protein family 1 [Brucella
           pinnipedialis M163/99/10]
 gi|261318631|ref|ZP_05957828.1| extracellular solute-binding protein family 1 [Brucella
           pinnipedialis B2/94]
 gi|261320179|ref|ZP_05959376.1| extracellular solute-binding protein family 1 [Brucella ceti
           M644/93/1]
 gi|261750399|ref|ZP_05994108.1| extracellular solute-binding protein family 1 [Brucella suis bv. 5
           str. 513]
 gi|261753656|ref|ZP_05997365.1| extracellular solute-binding protein family 1 [Brucella suis bv. 3
           str. 686]
 gi|261756898|ref|ZP_06000607.1| bacterial extracellular solute-binding protein [Brucella sp. F5/99]
 gi|265986431|ref|ZP_06098988.1| extracellular solute-binding protein [Brucella pinnipedialis
           M292/94/1]
 gi|265989999|ref|ZP_06102556.1| extracellular solute-binding protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265992890|ref|ZP_06105447.1| extracellular solute-binding protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265996124|ref|ZP_06108681.1| extracellular solute-binding protein [Brucella ceti M490/95/1]
 gi|17984761|gb|AAL53826.1| iron(iii)-binding periplasmic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|161337568|gb|ABX63872.1| extracellular solute-binding protein family 1 [Brucella canis ATCC
           23365]
 gi|163675552|gb|A