RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780563|ref|YP_003064976.1| extracellular solute-binding protein [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >gnl|CDD|162273 TIGR01256, modA, molybdenum ABC transporter, periplasmic molybdate-binding protein. The model describes the molybdate ABC transporter periplasmic binding protein in bacteria and archae. Several of the periplasmic receptors constitute a diverse class of binding proteins that differ widely in size, sequence and ligand specificity. It has been shown experimentally by radioactive labeling that ModA represent hydrophylioc periplasmic-binding protein in gram-negative organisms and its counterpart in gram-positive organisms is a lipoprotein. The other components of the system include the ModB, an integral membrane protein and ModC the ATP-binding subunit. Invariably almost all of them display a common beta/alpha folding motif and have similar tertiary structures consisting of two globular domains. Length = 216 Score = 35.1 bits (81), Expect = 0.011 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 5/104 (4%) Query: 40 MLPIIHSFEERTGVKISPIYTSSIQ-RPPITQGSPVDVIITKDETSL--ALNEDLLHKLP 96 + I FE+RTG K+ + SS I G+P D+ I+ D +++ L+ Sbjct: 8 LKEIAKQFEKRTGNKVVFSFGSSGTLYTQIENGAPADLFISADNKWPKKLVDKGLVVAGS 67 Query: 97 AHLIKKNSFVLKNENKKLMRISFDTQVLAYSTKRIKIADLPKSV 140 N VL + +++ D + KR+ I D PK Sbjct: 68 RFTYAGNKLVLISPKNRVVD-DLDILKKWVADKRVAIGD-PKHA 109 >gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated. Length = 407 Score = 27.9 bits (63), Expect = 1.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 131 IKIADLPKSVFDLTNAQWKK 150 IK+ LP+SV + T A W K Sbjct: 5 IKVPTLPESVTEATIATWHK 24 >gnl|CDD|161880 TIGR00440, glnS, glutaminyl-tRNA synthetase. This protein is a relatively rare aminoacyl-tRNA synthetase, found in the cytosolic compartment of eukaryotes, in E. coli and a number of other Gram-negative Bacteria, and in Deinococcus radiodurans. In contrast, the pathway to Gln-tRNA in mitochondria, Archaea, Gram-positive Bacteria, and a number of other lineages is by misacylation with Glu followed by transamidation to correct the aminoacylation to Gln. This enzyme is a class I tRNA synthetase (hit by the pfam model tRNA-synt_1c) and is quite closely related to glutamyl-tRNA synthetases. Length = 522 Score = 28.0 bits (62), Expect = 1.9 Identities = 24/115 (20%), Positives = 45/115 (39%), Gaps = 15/115 (13%) Query: 80 KDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRI--SFDTQVLAYSTKRIKIADLP 137 K L L +++ + A++IK V K+ K+ I ++D + L + Sbjct: 372 KQYKRLVLGKEVRLRN-AYVIKAER-VEKDAAGKITTIFCTYDNKTLGKEPADGR---KV 426 Query: 138 KSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK 192 K V W +S + + RL + + + PN DF+ I ++ K Sbjct: 427 KGVI-----HW---VSASSKYPTETRLYDRLFKVPNPGAPDDFLSVINPESLVIK 473 >gnl|CDD|180912 PRK07269, PRK07269, cystathionine gamma-synthase; Reviewed. Length = 364 Score = 27.5 bits (61), Expect = 2.6 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query: 44 IHSFEERTGVKISPIYTSSI-QRPPITQGSPVDVIITKDETSLALNEDL 91 I S +E TG ++P++ S+ Q P Q + D TK+ T L E L Sbjct: 16 IKS-DEATGALVTPLHFSTTYQHPEFGQSTGFDYTRTKNPTRAKLEETL 63 >gnl|CDD|181896 PRK09482, PRK09482, flap endonuclease-like protein; Provisional. Length = 256 Score = 25.6 bits (57), Expect = 9.4 Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 70 QGSPVDVIITKDETSLALNEDLLHKLPAHLI 100 Q SP D+ + AL++ + H P H + Sbjct: 21 QPSPNDINACVETCQHALDKLIRHSQPTHAV 51 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.133 0.371 Gapped Lambda K H 0.267 0.0671 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,009,525 Number of extensions: 176903 Number of successful extensions: 354 Number of sequences better than 10.0: 1 Number of HSP's gapped: 353 Number of HSP's successfully gapped: 23 Length of query: 195 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 107 Effective length of database: 4,092,969 Effective search space: 437947683 Effective search space used: 437947683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (24.7 bits)