HHsearch alignment for GI: 254780564 and conserved domain: PRK09501

>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed.
Probab=98.74  E-value=4.4e-08  Score=64.37  Aligned_cols=70  Identities=24%  Similarity=0.332  Sum_probs=57.6

Q ss_pred             HHHHHHHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCC
Q ss_conf             999985148785355046589985106865412163169988999999999839999999974002100106876
Q gi|254780564|r    6 SVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII   80 (107)
Q Consensus         6 y~~~~k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~   80 (107)
T Consensus       232 da~~~~~~~~~i~~v~----PkE-G~~~w~D~~~Ipk~A~n~e~A~~FInf~l~Pevaa~~a~~~~y~t~n~~A~  301 (348)
T PRK09501        232 SAFVARQAGTPIDVVW----PKE-GGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAETIGYPTPNLAAR  301 (348)
T ss_pred             HHHHHHHCCCCCCEEE----CCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHHCCCCHHHHHH
T ss_conf             8999997089971897----578-866998998898999898999999998619799999999748898308888