HHsearch results for GI: 254780564 and protein with PDBid: 1eu8_A

>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1
Probab=98.30  E-value=8.1e-07  Score=56.37  Aligned_cols=70  Identities=26%  Similarity=0.273  Sum_probs=55.0

Q ss_pred             CCCEEECCCCCCC-CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCC
Q ss_conf             8535504658998-510686541216316998899999999983999999997400210010687674210
Q gi|254780564|r   16 EVSVSYTPFLPKD-IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKF   85 (107)
Q Consensus        16 ~~~v~~~~f~~~D-~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~   85 (107)
                      ++++...|-.+++ .+..+...+.+|.++++|+++|.+||+||+|++.|..++......|+.+.+..++.+
T Consensus       273 ~~~~~~~P~~~~~~~~~~~~~~~~~i~~~s~~~e~A~~fl~~l~s~e~~~~~~~~~g~~P~~~~~~~~~~~  343 (409)
T 1eu8_A          273 KVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAV  343 (409)
T ss_dssp             CEEEECCCBCTTSCCCCBEEEEEEEEBTTCSCHHHHHHHHHHHTSHHHHHHHHHHTCCCBSBTTGGGSHHH
T ss_pred             CEEEECCCCCCCCCCCCEECCCEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCHHHHHCHHH
T ss_conf             63683156678886420005610244567877999999999966999999999854998662767619875