HHsearch results for GI: 254780564 and protein with PDBid: 2hxw_A

>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A*
Probab=98.27  E-value=5e-07  Score=57.48  Aligned_cols=44  Identities=5%  Similarity=0.009  Sum_probs=38.7

Q ss_pred             CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCC
Q ss_conf             10686541216316998899999999983999999997400210
Q gi|254780564|r   30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEY   73 (107)
Q Consensus        30 G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~ey   73 (107)
                      |....+..++|++.++|+++|++||+||+|+|+|++|...-|..
T Consensus       188 ~~~~~~~~~~i~~~~~~~~~A~~Fi~fl~S~e~q~i~~~~Gf~~  231 (237)
T 2hxw_A          188 KDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRE  231 (237)
T ss_dssp             TTTCCEEEEEEEECTTCCHHHHHHHHHTTSHHHHHHHHHTTCBC
T ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHCCCCC
T ss_conf             98525877999958999499999999978999999999859987