PSIBLAST alignment of GI: 254780564 and protein with PDB id: 3kn7

>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant Holo Ferric Ion-Binding Protein A Length = 309
 Score = 66.9 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 39/108 (36%), Gaps = 3/108 (2%)

Query: 1   MINASSVAIFKNHH--SEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLL 58
           +IN +             +         +D G ++  +   + ++SK ++ A +F+ FL 
Sbjct: 191 LINNAYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLA 250

Query: 59  LPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPP 106
               Q+ +  A  EYP+   +++                   TAQ+  
Sbjct: 251 SKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVS-ATTAQDKE 297