RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) >gnl|CDD|183039 PRK11205, tbpA, thiamine transporter substrate binding subunit; Provisional. Length = 330 Score = 36.9 bits (86), Expect = 0.001 Identities = 14/41 (34%), Positives = 22/41 (53%) Query: 37 VGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIK 77 V +SK+ +A +FL+F++ P Q I T YP+ K Sbjct: 249 VAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVAK 289 >gnl|CDD|130321 TIGR01254, sfuA, ABC transporter periplasmic binding protein, thiB subfamily. The model describes thiamine ABC transporter, periplasmic protein in bacteria and archae. The protein belongs to the larger ABC transport system. It consists of at least three components: the thiamine binding periplasmic protein; an inner membrane permease; an ATP-binding subunit. It has been experimentally demonstrated that the mutants in the various steps in the de novo synthesis of the thiamine and the biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate (TPP). Length = 304 Score = 36.4 bits (84), Expect = 0.002 Identities = 16/51 (31%), Positives = 27/51 (52%) Query: 30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII 80 G+ L + +K+ +A +F++FLL P VQ I T YP++ G + Sbjct: 222 GHYLQVEGAARLKGAKQPELADKFVQFLLSPAVQNAIPTGNWMYPVVNGTL 272 >gnl|CDD|130343 TIGR01276, thiB, thiamine ABC transporter, periplasmic binding protein. This model finds the thiamine (and thiamine pyrophosphate) ABC transporter periplasmic binding protein ThiB in proteobacteria. Completed genomes having this protein (E. coli, Vibrio cholera, Haemophilus influenzae) also have the permease ThiP, described by TIGRFAMs equivalog model TIGR01253. Length = 309 Score = 33.1 bits (75), Expect = 0.016 Identities = 16/51 (31%), Positives = 25/51 (49%) Query: 30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII 80 G+ L V +SK+ +A +FL+FL+ P Q I T YP+ + Sbjct: 221 GHYLQVEVAARTAASKQPELAQKFLQFLVSPAFQNAIPTGNWMYPVANVTL 271 >gnl|CDD|177754 PLN00151, PLN00151, potassium transporter; Provisional. Length = 852 Score = 28.6 bits (64), Expect = 0.35 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 67 ATALGEYPIIKGIITNRKFNDQTY 90 + ALG +P +K I T+RKF Q Y Sbjct: 447 SMALGCFPRLKIIHTSRKFMGQIY 470 >gnl|CDD|180534 PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional. Length = 166 Score = 25.9 bits (57), Expect = 2.2 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 58 LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99 L + +QY+ Y I+G + RK+ DQ+ R S E++ Sbjct: 64 LCKVAEQYLKKGAKVY--IEGQLQTRKWTDQSGVERYSTEVV 103 >gnl|CDD|162407 TIGR01537, portal_HK97, phage portal protein, HK97 family. This model represents one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 KDa. Length = 341 Score = 25.8 bits (57), Expect = 2.7 Identities = 11/47 (23%), Positives = 16/47 (34%), Gaps = 12/47 (25%) Query: 52 QFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFEL 98 FLRF L PI++Q NRK ++ + Sbjct: 265 DFLRFTLNPIIEQIEQE------------LNRKLLTESEREGYYIKF 299 >gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional. Length = 182 Score = 25.5 bits (56), Expect = 3.1 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query: 58 LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99 L IV +Y+ Y I+G I RK+ Q +R S E++ Sbjct: 62 LAEIVGEYLKKGSSVY--IEGRIRTRKWQGQDGQDRYSTEIV 101 >gnl|CDD|178361 PLN02761, PLN02761, lipase class 3 family protein. Length = 527 Score = 25.0 bits (54), Expect = 4.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 74 PIIKGIITNRKFNDQTY 90 P + GI TN KF Q Y Sbjct: 369 PSVPGIFTNEKFQFQKY 385 >gnl|CDD|131755 TIGR02708, L_lactate_ox, L-lactate oxidase. Members of this protein oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide. The enzyme is known in Aerococcus viridans, Streptococcus iniae, and some strains of Streptococcus pyogenes where it appears to contribute to virulence. Length = 367 Score = 24.9 bits (54), Expect = 4.8 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Query: 35 STVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALG 71 +TVGG E + F+ + +PIVQ+Y+ T G Sbjct: 169 ATVGGNREVDVR----NGFVFPVGMPIVQEYLPTGAG 201 >gnl|CDD|182645 PRK10682, PRK10682, putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional. Length = 370 Score = 24.4 bits (53), Expect = 6.3 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query: 17 VSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATAL 70 V+VSY+ +PK+ G + V + +K K A QFL +LL P V +I+ + Sbjct: 262 VNVSYS--IPKE-GALAFFDVFAMPADAKNKDEAYQFLNYLLRPDVIAHISDHV 312 >gnl|CDD|182743 PRK10801, PRK10801, colicin uptake protein TolQ; Provisional. Length = 227 Score = 24.4 bits (53), Expect = 6.6 Identities = 25/96 (26%), Positives = 39/96 (40%), Gaps = 13/96 (13%) Query: 9 IFKNHHSEVSVSYTPFLPKDIGNI-----LCSTVGGIAESSKKKSVATQFLRFLLLP-IV 62 I N E ++ PFL +G+I L TV GI + Q ++ P I Sbjct: 111 ISMNRELETLETHIPFL-GTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIA 169 Query: 63 QQYIATALGEYPIIKGIITNRKFN------DQTYTN 92 + IATA+G + I ++ + N + Y N Sbjct: 170 EALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDN 205 >gnl|CDD|178696 PLN03151, PLN03151, cation/calcium exchanger; Provisional. Length = 650 Score = 24.3 bits (53), Expect = 7.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 4 ASSVAIFKNHHSEVSV 19 AS+VAI+ NH ++ SV Sbjct: 352 ASNVAIYSNHFAKGSV 367 >gnl|CDD|162408 TIGR01538, portal_SPP1, phage portal protein, SPP1 family. This model represents one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 KDa. Length = 412 Score = 24.0 bits (52), Expect = 8.9 Identities = 12/49 (24%), Positives = 22/49 (44%), Gaps = 7/49 (14%) Query: 15 SEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQ 63 E+ +++T PK++ I+ S S++ +VA P VQ Sbjct: 369 KELKITFTRNRPKNLSEIVESLKQLGGIMSQETAVA-------RNPFVQ 410 >gnl|CDD|148278 pfam06576, DUF1133, Protein of unknown function (DUF1133). This family consists of a number of hypothetical proteins from Escherichia coli O157:H7 and Salmonella typhi. The function of this family is unknown. Length = 176 Score = 24.1 bits (52), Expect = 9.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 61 IVQQYIATALGEYPIIKGIITNR 83 + + I+ LGEYP + I+ R Sbjct: 103 KIDRVISEVLGEYPGLISILRQR 125 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0594 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,594,270 Number of extensions: 83432 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 168 Number of HSP's successfully gapped: 18 Length of query: 107 Length of database: 5,994,473 Length adjustment: 73 Effective length of query: 34 Effective length of database: 4,417,089 Effective search space: 150181026 Effective search space used: 150181026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)