RPSBLAST alignment of GI: 254780564 and SCOP domain: d1xvxa_

Alignment
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Length = 311
 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 17/83 (20%), Positives = 30/83 (36%), Gaps = 1/83 (1%)

Query: 1   MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60
                 V   K   +        F  +D G  +  + GG+  SSK    A +F++++   
Sbjct: 195 YHYYRFVDQAKTGENSGKTQLHYFKHQDPGAFVSISGGGVLASSKHPKEAQEFVKWITGK 254

Query: 61  IVQQYIATA-LGEYPIIKGIITN 82
             Q  + T    EY +     +N
Sbjct: 255 SGQDILRTNNAFEYAVGVDAASN 277

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Yersinia enterocolitica, YfuA [TaxId: 630]