BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 219 bits (559), Expect = 6e-60, Method: Compositional matrix adjust. Identities = 107/107 (100%), Positives = 107/107 (100%) Query: 1 MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60 MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP Sbjct: 1 MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60 Query: 61 IVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK 107 IVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK Sbjct: 61 IVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK 107 >gi|254780183|ref|YP_003064596.1| single-strand binding protein (ssb) [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 29.3 bits (64), Expect = 0.019, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 58 LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99 L IV+QY+ Y I+G + RK+ DQ+ NR + E+I Sbjct: 64 LCRIVEQYLRKGSKVY--IEGSLQTRKWQDQSGNNRYTTEII 103 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 21.9 bits (45), Expect = 3.0, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 74 PIIKGIITNRKFNDQTYTNRESFE 97 P+I G I+NR+ + +E +E Sbjct: 49 PLIVGAISNRRVYTHLLSYKEGYE 72 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 21.6 bits (44), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/30 (26%), Positives = 17/30 (56%) Query: 33 LCSTVGGIAESSKKKSVATQFLRFLLLPIV 62 C+ + + ++S+K+S+A+ F P V Sbjct: 41 FCNMLWKLLQNSRKESIASHFAVIFDYPAV 70 >gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 20.8 bits (42), Expect = 6.4, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 63 QQYIATALGEYPIIKGIITNRKF 85 +Q+I L E+ +K +IT KF Sbjct: 105 EQFIQKVLVEWLEVKTVITGTKF 127 >gi|254780902|ref|YP_003065315.1| isocitrate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 20.8 bits (42), Expect = 6.4, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 8 AIFKNHHSEVSVSYTPFLPKDI 29 A FKN E+ ++YT L D+ Sbjct: 231 AEFKNQFDELGITYTHRLIDDM 252 >gi|254780442|ref|YP_003064855.1| pyruvate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 20.0 bits (40), Expect = 9.9, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 27 KDIGNILCSTVGGIAESSKK 46 K IG I C + GI+ + +K Sbjct: 138 KGIGFIKCKVIAGISIADRK 157 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.133 0.374 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,655 Number of Sequences: 1233 Number of extensions: 2149 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 107 length of database: 328,796 effective HSP length: 62 effective length of query: 45 effective length of database: 252,350 effective search space: 11355750 effective search space used: 11355750 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)