RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780565|ref|YP_003064978.1| hypothetical protein CLIBASIA_02260 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >gnl|CDD|162663 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase. This model represents the S-adenosylmethionine-dependent O-methyltransferase responsible for methylation of magnesium protoporphyrin IX. This step is essentiasl for the biosynthesis of both chlorophyll and bacteriochlorophyll. This model encompasses two closely related clades, from cyanobacteria (and plants) where it is called ChlM and other photosynthetic bacteria where it is known as BchM. Length = 219 Score = 24.8 bits (54), Expect = 4.7 Identities = 7/20 (35%), Positives = 9/20 (45%) Query: 38 RVSSFKKSSFGFYIVMLLSF 57 ++ S GFY MLL Sbjct: 200 KIVREGLVSTGFYNSMLLEI 219 >gnl|CDD|185058 PRK15103, PRK15103, paraquat-inducible membrane protein A; Provisional. Length = 419 Score = 24.6 bits (54), Expect = 5.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Query: 57 FFAGVLVSFFGLI 69 F AGVLVSF L+ Sbjct: 151 FLAGVLVSFVKLM 163 >gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed. Length = 457 Score = 24.5 bits (54), Expect = 7.1 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query: 10 KSRMNLAVEDKETRLY-RRYWEGEYKT 35 + + +AV D T L+ RRY++ K Sbjct: 286 EQSIEMAVTDGLTGLHNRRYFDMHLKN 312 >gnl|CDD|178358 PLN02758, PLN02758, oxidoreductase, 2OG-Fe(II) oxygenase family protein. Length = 361 Score = 24.4 bits (53), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 17 VEDKETRLYRRYWEGEY 33 V+D+ YRRY GEY Sbjct: 323 VDDENPCKYRRYNHGEY 339 >gnl|CDD|149186 pfam07970, COPIIcoated_ERV, Endoplasmic reticulum vesicle transporter. This family is conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localisation. All proteins identified biochemically as Erv41p-Erv46p interactors are localized to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi. Length = 221 Score = 23.8 bits (52), Expect = 9.9 Identities = 8/31 (25%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 39 VSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI 69 +++ + SF ++ L + GV + GLI Sbjct: 191 INTEDRQSFSHFLTNLCAIIGGVF-AVAGLI 220 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.138 0.399 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,071,287 Number of extensions: 50472 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 246 Number of HSP's successfully gapped: 27 Length of query: 69 Length of database: 5,994,473 Length adjustment: 40 Effective length of query: 29 Effective length of database: 5,130,153 Effective search space: 148774437 Effective search space used: 148774437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.0 bits)