RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780565|ref|YP_003064978.1| hypothetical protein CLIBASIA_02260 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >2w39_A Putative laminarinase; hydrolase, white ROT fungus, glycosyl hydrolase, GH7, GH16, LAM16A, family 16, beta-glucan, basidiomycete; HET: NAG BGC LGC; 1.10A {Phanerochaete chrysosporium} PDB: 2cl2_A* 2w52_A* (A:) Length = 298 Score = 26.1 bits (56), Expect = 1.8 Identities = 5/31 (16%), Positives = 9/31 (29%) Query: 22 TRLYRRYWEGEYKTSGRVSSFKKSSFGFYIV 52 G + S R+ S K + + Sbjct: 57 DHTTTLSPSGPGRNSVRIRSIKTYTTHVAVF 87 >2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} (A:) Length = 102 Score = 25.2 bits (55), Expect = 2.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Query: 37 GRVSSFKKSSFGFYIVMLLSFFAGVLVSF 65 G++S KSS GF IV L A Sbjct: 73 GQLSGVIKSSVGFLIVRLDDIQAAHHHHH 101 >2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A (A:) Length = 212 Score = 24.5 bits (53), Expect = 5.8 Identities = 2/22 (9%), Positives = 4/22 (18%) Query: 16 AVEDKETRLYRRYWEGEYKTSG 37 + G + G Sbjct: 3 SSHHHHHHSSGLVPRGSHXALG 24 >1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} (A:) Length = 139 Score = 23.8 bits (51), Expect = 8.2 Identities = 4/20 (20%), Positives = 9/20 (45%) Query: 37 GRVSSFKKSSFGFYIVMLLS 56 G +S + G +I+ + Sbjct: 120 GDISDIVDTDSGVHIIKRTA 139 >1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} (A:62-177) Length = 116 Score = 23.8 bits (51), Expect = 8.2 Identities = 5/19 (26%), Positives = 11/19 (57%) Query: 37 GRVSSFKKSSFGFYIVMLL 55 G VS+ +++ G +I+ Sbjct: 97 GEVSNIIETNSGVHILQRT 115 >1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} (A:) Length = 96 Score = 23.7 bits (51), Expect = 9.9 Identities = 5/26 (19%), Positives = 10/26 (38%) Query: 30 EGEYKTSGRVSSFKKSSFGFYIVMLL 55 K+ FG++I+M+ Sbjct: 68 VSGMDKPVFTDPPVKTKFGYHIIMVE 93 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.138 0.399 Gapped Lambda K H 0.267 0.0586 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 479,382 Number of extensions: 15743 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 6 Length of query: 69 Length of database: 4,956,049 Length adjustment: 36 Effective length of query: 33 Effective length of database: 3,739,069 Effective search space: 123389277 Effective search space used: 123389277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.4 bits)