Query gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 70 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 22:45:35 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780568.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK09470 cpxA two-component se 48.2 22 0.00056 17.1 3.3 26 20-45 5-31 (461) 2 pfam06075 DUF936 Plant protein 41.5 18 0.00047 17.5 2.0 23 15-38 531-553 (557) 3 TIGR02753 sodN superoxide dism 37.7 29 0.00073 16.5 2.5 25 3-27 27-51 (149) 4 TIGR02767 TraG-Ti Ti-type conj 35.4 24 0.00061 16.9 1.8 16 16-31 495-512 (641) 5 pfam11099 M11L Apoptosis regul 31.0 17 0.00044 17.6 0.5 18 40-57 79-96 (167) 6 pfam07184 CTV_P33 Citrus trist 18.3 65 0.0017 14.6 1.4 24 31-54 278-301 (303) 7 pfam11106 YjbE Exopolysacchari 18.0 45 0.0012 15.4 0.6 12 20-31 1-12 (80) 8 pfam03326 Herpes_TAF50 Herpesv 17.4 89 0.0023 13.9 5.1 41 10-50 57-97 (500) 9 KOG3319 consensus 17.0 91 0.0023 13.9 3.2 39 31-69 23-63 (153) 10 KOG4583 consensus 16.2 96 0.0025 13.8 5.8 33 33-65 269-301 (391) No 1 >PRK09470 cpxA two-component sensor protein; Provisional Probab=48.17 E-value=22 Score=17.05 Aligned_cols=26 Identities=31% Similarity=0.663 Sum_probs=13.7 Q ss_pred HHHHHHH-HHHHHHHHHHHHHHHHHHH Q ss_conf 9999999-9999999999999999999 Q gi|254780568|r 20 MRKKLYG-IFLMMWICYAAIILSVSLL 45 (70) Q Consensus 20 mrkklyg-iflmmwicyaaiilsvsll 45 (70) |.+.||+ ||+..|+|-+.++..+.++ T Consensus 5 m~nsL~~RIfl~Fwltl~lil~~~~~~ 31 (461) T PRK09470 5 MINSLTARIFAIFWLTLALVLMLVLML 31 (461) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 512299999999999999999999999 No 2 >pfam06075 DUF936 Plant protein of unknown function (DUF936). This family consists of several hypothetical proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown. Probab=41.47 E-value=18 Score=17.46 Aligned_cols=23 Identities=43% Similarity=0.632 Sum_probs=14.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999 Q gi|254780568|r 15 VILERMRKKLYGIFLMMWICYAAI 38 (70) Q Consensus 15 vilermrkklygiflmmwicyaai 38 (70) --.||.|||+||..| -.+-.||- T Consensus 531 e~ierLrkKIY~~LL-~HVesAa~ 553 (557) T pfam06075 531 EKIERLRKKIYGFLL-EHVESAAS 553 (557) T ss_pred HHHHHHHHHHHHHHH-HHHHHHHH T ss_conf 799999999999999-98899999 No 3 >TIGR02753 sodN superoxide dismutase, Ni; InterPro: IPR014123 This entry represents nickel-dependent superoxide dismutase (NiSOD) (1.15.1.1 from EC), a SOD enzyme that uses nickel, rather than iron, manganese, copper, or zinc. All SOD enzymes catalyse the dismutation of toxic superoxide radical anions to oxygen and hydrogen peroxide in order to protect cells from oxidative damage. The catalytic cycle of NiSOD consists of two half-reactions, each initiated by the successive approach of substrate to the metal centre. The first (reductive) phase involves Ni(III) reduction to Ni(II), and the second (oxidative) phase involves the metal reoxidation back to its resting state . NiSOD has a novel SOD fold and assembly, consisting of a hexameric assembly of 4-helix bundles of up-and-down topology, which contains a 9-residue nickel-hook structural motif that is critical for metal binding and catalysis . A gene for a required protease (NiSOD maturation protease; IPR014124 from INTERPRO) is adjacent to the NiSOD gene. ; GO: 0004784 superoxide dismutase activity, 0016151 nickel ion binding, 0016209 antioxidant activity. Probab=37.70 E-value=29 Score=16.48 Aligned_cols=25 Identities=32% Similarity=0.428 Sum_probs=22.0 Q ss_pred EEEHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 1100388889999999999999999 Q gi|254780568|r 3 QIYSPISERFLFVILERMRKKLYGI 27 (70) Q Consensus 3 qiyspiserflfvilermrkklygi 27 (70) .||.|++-|.----.-+|.+||.+. T Consensus 27 gvYDPa~ari~ae~v~~m~~kl~~l 51 (149) T TIGR02753 27 GVYDPASARISAEAVLAMTKKLAAL 51 (149) T ss_pred CCCCCCHHHHHHHHHHHHHHHHHHC T ss_conf 7207602268999999999998625 No 4 >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG; InterPro: IPR014135 This entry contains the Agrobacterium tumefaciens Ti-plasmid TraG, it is responsible for conjugative transfer of the entire plasmid among Agrobacterium strains . The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems.. Probab=35.42 E-value=24 Score=16.87 Aligned_cols=16 Identities=50% Similarity=0.860 Sum_probs=10.2 Q ss_pred HHHHHH--HHHHHHHHHH Q ss_conf 999999--9999999999 Q gi|254780568|r 16 ILERMR--KKLYGIFLMM 31 (70) Q Consensus 16 ilermr--kklygiflmm 31 (70) |||.-| -.-||+-||| T Consensus 495 iLEeARDrGRKYG~sl~l 512 (641) T TIGR02767 495 ILEEARDRGRKYGVSLML 512 (641) T ss_pred HHHHHHHCCCHHHHHHHH T ss_conf 888774167613589999 No 5 >pfam11099 M11L Apoptosis regulator M11L like. Apoptosis regulators function to modulate the apoptotic cascades and thereby favour productive viral replication. M11L inhibits mitochondrial-dependant apoptosis by mimicking and competing with host proteins for the binding and blocking of Bak and Bax, two executioner proteins. Probab=30.99 E-value=17 Score=17.61 Aligned_cols=18 Identities=44% Similarity=0.514 Sum_probs=14.2 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780568|r 40 LSVSLLALSFLSMIITVA 57 (70) Q Consensus 40 lsvsllalsflsmiitva 57 (70) .||-|-.+||+|+|+.-- T Consensus 79 PSVkLAtiSliS~I~kk~ 96 (167) T pfam11099 79 PSVKLATISLLSIIIKKL 96 (167) T ss_pred CCEEEHHHHHHHHHHHHH T ss_conf 742007999999999984 No 6 >pfam07184 CTV_P33 Citrus tristeza virus P33 protein. This family consists of several Citrus tristeza virus (CTV) P33 proteins. The function of P33 is unclear although it is known that the protein is not needed for virion formation. Probab=18.27 E-value=65 Score=14.63 Aligned_cols=24 Identities=50% Similarity=0.600 Sum_probs=18.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999 Q gi|254780568|r 31 MWICYAAIILSVSLLALSFLSMII 54 (70) Q Consensus 31 mwicyaaiilsvsllalsflsmii 54 (70) ---|||.-.|-||||-.|-|-.|| T Consensus 278 rvccyavcvlvvsllimsgllaii 301 (303) T pfam07184 278 RVCCYAVCVLVVSLLIMSGLLAII 301 (303) T ss_pred HHHHHHHHHHHHHHHHHHCCHHEE T ss_conf 999999999999999984222057 No 7 >pfam11106 YjbE Exopolysaccharide production protein YjbE. YjbE is part of a four gene operon which is involved in exopolysaccharide production. The expression of YjbE is higher than the rest of the operon yjbEFGH. It appears to be restricted to Enterobacteriaceae. Probab=17.95 E-value=45 Score=15.45 Aligned_cols=12 Identities=50% Similarity=0.789 Sum_probs=9.5 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254780568|r 20 MRKKLYGIFLMM 31 (70) Q Consensus 20 mrkklygiflmm 31 (70) |+|-|||||-.- T Consensus 1 mkkil~gifai~ 12 (80) T pfam11106 1 MKKILSGIFAIA 12 (80) T ss_pred CHHHHHHHHHHH T ss_conf 903778889999 No 8 >pfam03326 Herpes_TAF50 Herpesvirus transcription activation factor (transactivator). This family includes EBV BRLF1 and similar ORF 50 proteins from other herpesviruses. Probab=17.43 E-value=89 Score=13.94 Aligned_cols=41 Identities=20% Similarity=0.190 Sum_probs=29.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 88999999999999999999999999999999999999999 Q gi|254780568|r 10 ERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFL 50 (70) Q Consensus 10 erflfvilermrkklygiflmmwicyaaiilsvsllalsfl 50 (70) -.-+|.+|..+|+|-+|-.-++--+-++|+-...-+-..|. T Consensus 57 a~~~~~ll~~~R~Kc~~~wr~lg~~R~~~M~~gk~v~~~y~ 97 (500) T pfam03326 57 AKALFKLLKECRKKCLGAWRRLGGGRRALMTLGKQVLTCYN 97 (500) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH T ss_conf 99999999999998888887724654999999899999998 No 9 >KOG3319 consensus Probab=16.98 E-value=91 Score=13.88 Aligned_cols=39 Identities=26% Similarity=0.421 Sum_probs=25.6 Q ss_pred HHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHCC Q ss_conf 9999999999999999999--99999999999999853106 Q gi|254780568|r 31 MWICYAAIILSVSLLALSF--LSMIITVAIALVQYLRGSFV 69 (70) Q Consensus 31 mwicyaaiilsvsllalsf--lsmiitvaialvqylrgsfv 69 (70) .|+.|.-+|+..-++-+|+ .|--..-..+.+-|--|+|+ T Consensus 23 ~Wl~yil~i~ll~l~~ls~p~~s~~~aWTltnl~h~~~tyi 63 (153) T KOG3319 23 AWLIYILIILLLHLVLLSIPFVSPPWAWTLTNLIHNIGTYI 63 (153) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHE T ss_conf 18999999999999998176678656687999999986752 No 10 >KOG4583 consensus Probab=16.16 E-value=96 Score=13.77 Aligned_cols=33 Identities=30% Similarity=0.455 Sum_probs=28.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999985 Q gi|254780568|r 33 ICYAAIILSVSLLALSFLSMIITVAIALVQYLR 65 (70) Q Consensus 33 icyaaiilsvsllalsflsmiitvaialvqylr 65 (70) +.-.+|.+|+-++--||...+..+.++++-||. T Consensus 269 f~r~aillSilyfySSf~RfllVm~aal~iYl~ 301 (391) T KOG4583 269 FFRVAILLSILYFYSSFSRFLLVMGAALFIYLH 301 (391) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999998899999999999999999 Done!