BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780568|ref|YP_003064981.1| hypothetical protein
CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62]
         (70 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040245|gb|ACT57041.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 70

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 70/70 (100%), Positives = 70/70 (100%)

Query: 1  MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60
          MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL
Sbjct: 1  MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60

Query: 61 VQYLRGSFVK 70
          VQYLRGSFVK
Sbjct: 61 VQYLRGSFVK 70


>gi|153801524|ref|ZP_01956110.1| mannosyl-transferase [Vibrio cholerae MZO-3]
 gi|124122929|gb|EAY41672.1| mannosyl-transferase [Vibrio cholerae MZO-3]
          Length = 624

 Score = 33.7 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65
          +RM   LY +F +M+  YAAI L +  LA +     FLSM+ TV + L  ++R
Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFNFPEFLSMMTTVGVTLYCFVR 68


>gi|229512757|ref|ZP_04402225.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21]
 gi|229350267|gb|EEO15219.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21]
          Length = 624

 Score = 33.7 bits (76), Expect = 8.3,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65
          +RM   LY +F +M+  YAAI L +  LA +     FLSM+ TV + L  ++R
Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68


>gi|254286286|ref|ZP_04961245.1| mannosyl-transferase [Vibrio cholerae AM-19226]
 gi|150423701|gb|EDN15643.1| mannosyl-transferase [Vibrio cholerae AM-19226]
          Length = 624

 Score = 33.7 bits (76), Expect = 8.3,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65
          +RM   LY +F +M+  YAAI L +  LA +     FLSM+ TV + L  ++R
Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68


>gi|15640289|ref|NP_229916.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121586321|ref|ZP_01676110.1| mannosyl-transferase [Vibrio cholerae 2740-80]
 gi|147674200|ref|YP_001218516.1| mannosyl-transferase [Vibrio cholerae O395]
 gi|153818272|ref|ZP_01970939.1| mannosyl-transferase [Vibrio cholerae NCTC 8457]
 gi|153818499|ref|ZP_01971166.1| mannosyl-transferase [Vibrio cholerae NCTC 8457]
 gi|153821796|ref|ZP_01974463.1| mannosyl-transferase [Vibrio cholerae B33]
 gi|229506943|ref|ZP_04396451.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae BX 330286]
 gi|229509314|ref|ZP_04398797.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae B33]
 gi|229516261|ref|ZP_04405709.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae RC9]
 gi|229521025|ref|ZP_04410446.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae TM 11079-80]
 gi|229527242|ref|ZP_04416635.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae 12129(1)]
 gi|229606454|ref|YP_002877102.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae MJ-1236]
 gi|255744066|ref|ZP_05418020.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholera CIRS 101]
 gi|262161955|ref|ZP_06030972.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae INDRE 91/1]
 gi|262168033|ref|ZP_06035732.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae RC27]
 gi|298500897|ref|ZP_07010699.1| mannosyl-transferase [Vibrio cholerae MAK 757]
 gi|1929425|emb|CAA69127.1| mannosyl-transferase [Vibrio cholerae]
 gi|9654669|gb|AAF93435.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121549441|gb|EAX59469.1| mannosyl-transferase [Vibrio cholerae 2740-80]
 gi|126510975|gb|EAZ73569.1| mannosyl-transferase [Vibrio cholerae NCTC 8457]
 gi|126511161|gb|EAZ73755.1| mannosyl-transferase [Vibrio cholerae NCTC 8457]
 gi|126520692|gb|EAZ77915.1| mannosyl-transferase [Vibrio cholerae B33]
 gi|146316083|gb|ABQ20622.1| mannosyl-transferase [Vibrio cholerae O395]
 gi|227012103|gb|ACP08313.1| mannosyl-transferase [Vibrio cholerae O395]
 gi|229335250|gb|EEO00734.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae 12129(1)]
 gi|229341910|gb|EEO06911.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae TM 11079-80]
 gi|229346687|gb|EEO11657.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae RC9]
 gi|229353629|gb|EEO18566.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae B33]
 gi|229356048|gb|EEO20967.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae BX 330286]
 gi|229369109|gb|ACQ59532.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae MJ-1236]
 gi|255738331|gb|EET93722.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholera CIRS 101]
 gi|262023566|gb|EEY42268.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae RC27]
 gi|262028333|gb|EEY46989.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio
          cholerae INDRE 91/1]
 gi|297540401|gb|EFH76460.1| mannosyl-transferase [Vibrio cholerae MAK 757]
          Length = 621

 Score = 33.7 bits (76), Expect = 8.6,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65
          +RM   LY +F +M+  YAAI L +  LA +     FLSM+ TV + L  ++R
Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68


>gi|227080475|ref|YP_002809026.1| mannosyl-transferase [Vibrio cholerae M66-2]
 gi|227008363|gb|ACP04575.1| mannosyl-transferase [Vibrio cholerae M66-2]
          Length = 621

 Score = 33.7 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65
          +RM   LY +F +M+  YAAI L +  LA +     FLSM+ TV + L  ++R
Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.340    0.148    0.426 

Lambda     K      H
   0.267   0.0478    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 999,566,457
Number of Sequences: 14124377
Number of extensions: 44145958
Number of successful extensions: 285789
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 23
Number of HSP's that attempted gapping in prelim test: 285768
Number of HSP's gapped (non-prelim): 32
length of query: 70
length of database: 4,842,793,630
effective HSP length: 42
effective length of query: 28
effective length of database: 4,249,569,796
effective search space: 118987954288
effective search space used: 118987954288
T: 11
A: 40
X1: 16 ( 7.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.9 bits)
S2: 76 (33.7 bits)