RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780571|ref|YP_003064984.1| hypothetical protein CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62] (182 letters) >gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion]. Length = 185 Score = 52.8 bits (126), Expect = 6e-08 Identities = 33/193 (17%), Positives = 64/193 (33%), Gaps = 23/193 (11%) Query: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM 60 + ++ + RF G AVE A++ P LLL+ + E + + + L A Sbjct: 5 RRGLRGLLRRFRRDRRGAAAVEFALVAPPLLLLVFGIVEFGIAFLAKQSLQNAADAAARA 64 Query: 61 VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE 120 A+ + + L + A + + + ++ Sbjct: 65 AARGLTTDAADL---DTIQAAATAFLNAIAPANAFLTVQSNTPSRGTVTVTANVAD---- 117 Query: 121 REDIPASIKDASTFIVRAEVSINY---RTLVFSKILPD--------SLKGDIVLRKVYYY 169 A++ D S F V + V+++ R LV ++PD S I + Sbjct: 118 -----ATLFDTSQFTVTSAVTVSINLARGLVLVAVVPDLTGPGTSGSRSATIPVGATTLV 172 Query: 170 RQRLGDQIVCRDC 182 R R+ + I Sbjct: 173 RVRIDETITPGID 185 >gnl|CDD|37421 KOG2210, KOG2210, KOG2210, Oxysterol-binding protein [Signal transduction mechanisms]. Length = 392 Score = 33.4 bits (76), Expect = 0.038 Identities = 20/102 (19%), Positives = 34/102 (33%), Gaps = 15/102 (14%) Query: 10 RFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFA------------SHM 57 +FL +AV M + LL + Y IT ++ + A Sbjct: 173 KFLGNS---IAVAMIGKGVLKLLDHDETYLITFPNAYARGILLGAPWVELGGKVVIECPK 229 Query: 58 GDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYW 99 + A SI K +L G +F ++ ++G W Sbjct: 230 TGLSAILESILKPFLGGKNSFNARSIKGPIDKKDFCSISGEW 271 >gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion]. Length = 58 Score = 29.1 bits (65), Expect = 0.69 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 5/63 (7%) Query: 4 IKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQ 63 +K + RFL E+G A+E L+ +AV I TL L + +G + Sbjct: 1 MKKLLRRFLRDEDGATAIEYG-----LIAALIAVVIIAGGSTLGTALKGAFTAIGAALTG 55 Query: 64 ETS 66 + Sbjct: 56 AAA 58 >gnl|CDD|143919 pfam00151, Lipase, Lipase. Length = 329 Score = 27.8 bits (62), Expect = 1.7 Identities = 10/43 (23%), Positives = 15/43 (34%), Gaps = 8/43 (18%) Query: 82 TMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDI 124 T Y T N + V G V K+ + V E++ Sbjct: 116 TFYRQATLN--VRVVG------AEVAKLLVELEEELNVSPENV 150 >gnl|CDD|145933 pfam03048, Herpes_UL92, UL92 family. Members of this family, found in several herpesviruses, include EBV BDLF4, HCMV UL92, HHV8 31, HSV6 U63. Their function is unknown. The N terminus of this protein contains 6 conserved cysteines and histidines that might form a zinc binding domain (A Bateman pers. obs.). Length = 192 Score = 27.6 bits (62), Expect = 2.0 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 3 CIKNYILRFLSRENGVVAVEMAII 26 +K+ + + SR N V+ AI Sbjct: 89 SLKSDVYSYFSRSNVYAEVKQAIF 112 >gnl|CDD|37856 KOG2645, KOG2645, KOG2645, Type I phosphodiesterase/nucleotide pyrophosphatase [General function prediction only]. Length = 418 Score = 27.2 bits (60), Expect = 2.9 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 83 MYPYRT-PNHSIIVTGYWLDNKQIV-RKMWNWSSSNV 117 ++P +T PNH IVTG + ++ IV ++ ++ Sbjct: 62 VFPTKTFPNHYSIVTGLYPESHGIVGNYFFDPKTNKE 98 >gnl|CDD|153334 cd07650, F-BAR_Syp1p_like, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of yeast Syp1 protein. F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Syp1p is associated with septins, a family of GTP-binding proteins that serve as elements of septin filaments, which are required for cell morphogenesis and division. Syp1p regulates cell-cycle dependent septin cytoskeletal dynamics in yeast. It contains an N-terminal F-BAR domain and a C-terminal domain of unknown function named SAFF which is also present in FCH domain Only (FCHO) proteins and endophilin interacting protein 1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. Length = 228 Score = 26.1 bits (58), Expect = 5.4 Identities = 8/36 (22%), Positives = 14/36 (38%) Query: 43 LYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENF 78 L L L +F +H D + T ++ + F Sbjct: 174 LNHLKDVLLQFQTHESDYALRTTESAEECMNQLLEF 209 >gnl|CDD|133127 cd06596, GH31_CPE1046, CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. Length = 261 Score = 25.8 bits (57), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 5/22 (22%) Query: 65 TSINKQYLQGFENFLRATMYPY 86 TSIN+ YL+ L+ + PY Sbjct: 243 TSINRDYLK-----LKMRLMPY 259 >gnl|CDD|33391 COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]. Length = 251 Score = 25.6 bits (56), Expect = 8.3 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 4/46 (8%) Query: 90 NHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFI 135 N I V GY D I MW S KV DA T Sbjct: 161 NDRITVIGYPGDKPNIG-TMW---ESTGKVNSIKGNKLFYDADTLP 202 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.138 0.411 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,195,691 Number of extensions: 108127 Number of successful extensions: 369 Number of sequences better than 10.0: 1 Number of HSP's gapped: 369 Number of HSP's successfully gapped: 18 Length of query: 182 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 94 Effective length of database: 4,362,145 Effective search space: 410041630 Effective search space used: 410041630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.5 bits)