RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780571|ref|YP_003064984.1| hypothetical protein CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62] (182 letters) >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Length = 183 Score = 26.0 bits (57), Expect = 2.1 Identities = 13/58 (22%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Query: 59 DMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWN-WSSS 115 + V Q T N + ++ + P+ H++ V G N Q WN W + Sbjct: 100 NQVDQLTKDNVGIMILAQSVSQNPNDPH--LGHALAVVGNAKINDQEKLIYWNPWDTE 155 >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Score = 24.9 bits (53), Expect = 4.6 Identities = 7/52 (13%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Query: 89 PNHSIIV---TGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVR 137 P H+++ Y + I + ++ + + DI ++A + Sbjct: 166 PLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPA 217 >d2nn6g2 b.84.4.2 (G:16-106) Ribosomal RNA-processing protein 40, RRP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Score = 24.7 bits (53), Expect = 5.3 Identities = 5/19 (26%), Positives = 10/19 (52%) Query: 86 YRTPNHSIIVTGYWLDNKQ 104 ++ P YW+D++Q Sbjct: 72 HKEPGSGSGGGVYWVDSQQ 90 >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Score = 24.3 bits (52), Expect = 5.6 Identities = 12/78 (15%), Positives = 24/78 (30%) Query: 95 VTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILP 154 V GY+ + +S V +I + T I + + IN Sbjct: 5 VIGYYFIPTNQINNYTETDTSVVPFPVSNITPAKAKQLTHINFSFLDINSNLECAWDPAT 64 Query: 155 DSLKGDIVLRKVYYYRQR 172 + K V+ ++ + Sbjct: 65 NDAKARDVVNRLTALKAH 82 >d3dtub2 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} Length = 100 Score = 24.4 bits (53), Expect = 6.1 Identities = 5/21 (23%), Positives = 14/21 (66%) Query: 26 ILPILLLIYMAVYEITMLYTL 46 I+PI++L+ + + + +L+ Sbjct: 77 IVPIVILVAIGAFSLPVLFNQ 97 >d3ehbb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]} Length = 107 Score = 24.1 bits (52), Expect = 7.2 Identities = 4/20 (20%), Positives = 14/20 (70%) Query: 25 IILPILLLIYMAVYEITMLY 44 ++P+L+L+ + + + +L+ Sbjct: 82 TLVPVLILVAIGAFSLPILF 101 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.326 0.138 0.411 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 688,435 Number of extensions: 29698 Number of successful extensions: 92 Number of sequences better than 10.0: 1 Number of HSP's gapped: 92 Number of HSP's successfully gapped: 12 Length of query: 182 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 102 Effective length of database: 1,309,196 Effective search space: 133537992 Effective search space used: 133537992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.3 bits)