BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780571|ref|YP_003064984.1| hypothetical protein CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62] (182 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780571|ref|YP_003064984.1| hypothetical protein CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 377 bits (968), Expect = e-107, Method: Compositional matrix adjust. Identities = 182/182 (100%), Positives = 182/182 (100%) Query: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM 60 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM Sbjct: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM 60 Query: 61 VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE 120 VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE Sbjct: 61 VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE 120 Query: 121 REDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCR 180 REDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCR Sbjct: 121 REDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCR 180 Query: 181 DC 182 DC Sbjct: 181 DC 182 >gi|254780897|ref|YP_003065310.1| trigger factor [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 25.0 bits (53), Expect = 0.87, Method: Compositional matrix adjust. Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 8/62 (12%) Query: 100 LDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKG 159 +D K+I R+M + +NV E ++ + I D +V+++Y V + IL D K Sbjct: 141 VDEKEIDRQMAEIAKNNVAFEVKETESEIGD--------KVTVDYTVSVDNVILEDQSKK 192 Query: 160 DI 161 ++ Sbjct: 193 NV 194 >gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 24.6 bits (52), Expect = 0.99, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 9/52 (17%) Query: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTR 52 M +KN FL E+G A+E LL+ +AV IT + TL +L + Sbjct: 3 MHIVKN----FLQDESGATAIEYG-----LLVSLIAVVIITSVTTLGGKLKK 45 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 23.1 bits (48), Expect = 3.0, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 15 ENGVVAVEMAIILPILLL 32 EN V+ +E+A+ LP+ LL Sbjct: 796 ENAVLLMELAVELPVSLL 813 >gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 22.3 bits (46), Expect = 4.7, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 9/51 (17%) Query: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLT 51 M +KN FL E+G A+E LL +AV I + TL +LT Sbjct: 3 MHIVKN----FLQDESGATAIEYG-----LLASLIAVAIIASVTTLGGKLT 44 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 22.3 bits (46), Expect = 5.9, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 6 NYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTR 52 N + FL E+G A+E LL +AV I + TL +L++ Sbjct: 4 NIVKDFLKDESGATAIEYG-----LLASLIAVAIIASVTTLGGKLSK 45 >gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Score = 21.9 bits (45), Expect = 6.8, Method: Compositional matrix adjust. Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Query: 82 TMYPYRTPNHSIIVTGYWLDNKQIVR--KMWNWSSSNVKVEREDIPASIKDASTFIVRAE 139 + P +TP S+IV G + K + S ++V+ +P + S F+ R+ Sbjct: 181 ALKPSKTPK-SLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSL 239 Query: 140 VSINYRTLVFSKILPDSLKGDIV 162 + L SKI KGD+V Sbjct: 240 QKRGIKILTESKISSVKQKGDMV 262 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.138 0.411 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,189 Number of Sequences: 1233 Number of extensions: 4049 Number of successful extensions: 17 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 8 length of query: 182 length of database: 328,796 effective HSP length: 69 effective length of query: 113 effective length of database: 243,719 effective search space: 27540247 effective search space used: 27540247 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 35 (18.1 bits)