BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780572|ref|YP_003064985.1| hypothetical protein CLIBASIA_02295 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780572|ref|YP_003064985.1| hypothetical protein CLIBASIA_02295 [Candidatus Liberibacter asiaticus str. psy62] Length = 192 Score = 397 bits (1020), Expect = e-113, Method: Compositional matrix adjust. Identities = 192/192 (100%), Positives = 192/192 (100%) Query: 1 MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR 60 MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR Sbjct: 1 MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR 60 Query: 61 KIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETV 120 KIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETV Sbjct: 61 KIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETV 120 Query: 121 PRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFL 180 PRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFL Sbjct: 121 PRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFL 180 Query: 181 LSSIVVFKNEPF 192 LSSIVVFKNEPF Sbjct: 181 LSSIVVFKNEPF 192 >gi|255764496|ref|YP_003065012.2| excinuclease ABC subunit C [Candidatus Liberibacter asiaticus str. psy62] Length = 616 Score = 32.3 bits (72), Expect = 0.006, Method: Compositional matrix adjust. Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 12/99 (12%) Query: 29 MPYFMLVFAILEISLSFTAGQ-LFESAAYDVARKIRTGEISSKNTHSLTEFRRVFCNDLR 87 MP V+ +L+I AG+ L+ AY++ ++I++ S+ +TH +T N++R Sbjct: 6 MPECPGVYQMLDI-----AGRVLYVGKAYNLQKRIKSYMHSNNHTHRITHMISQI-NNIR 59 Query: 88 VLFNCSENEIGRPYDLYLDVKQIKSLQEITETVPRKDKS 126 C+E E L L+ IK L+ + R DKS Sbjct: 60 FTVTCTEVEA-----LLLEANMIKRLKPRFNILLRDDKS 93 >gi|254780918|ref|YP_003065331.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 24.3 bits (51), Expect = 1.5, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 148 NVLRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLS 182 ++ R YHW + + Q I + + GK G+ L+ Sbjct: 260 HIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALN 294 >gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Score = 23.1 bits (48), Expect = 3.7, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 9/46 (19%) Query: 95 NEIGRPYDLYLDVKQIKSLQEITETVPRKDKSDSS--SEIDDRNFS 138 N+IGR D Y +K +K+ PR D S + ++DD +F+ Sbjct: 498 NQIGRMTDTYASLKDLKA-------DPRLDPSIKAFFKQLDDTDFT 536 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 22.7 bits (47), Expect = 4.8, Method: Compositional matrix adjust. Identities = 9/40 (22%), Positives = 17/40 (42%) Query: 59 ARKIRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIG 98 +K R G + +++S + +C D+ L E G Sbjct: 352 GKKERVGRMLQMHSNSREDIDEAYCGDIIALAGLKETTTG 391 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.139 0.403 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 115,160 Number of Sequences: 1233 Number of extensions: 4333 Number of successful extensions: 10 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 6 length of query: 192 length of database: 328,796 effective HSP length: 69 effective length of query: 123 effective length of database: 243,719 effective search space: 29977437 effective search space used: 29977437 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 36 (18.5 bits)