RPSBLAST alignment for GI: 254780573 and conserved domain: cd00814
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function. Length = 319
Score = 43.3 bits (103), Expect = 1e-04
Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 7/46 (15%)
Query: 268 NGFLNLEGRKMSKSNGNFITINELLETKKFGGRSWPAPVIRLAMLM 313
+G+L +EG+KMSKS GN + ++LLE + A +R +L
Sbjct: 271 HGYLTVEGKKMSKSRGNVVDPDDLLER-------YGADALRYYLLR 309