BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780575|ref|YP_003064988.1| hypothetical protein CLIBASIA_02310 [Candidatus Liberibacter asiaticus str. psy62] (316 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780575|ref|YP_003064988.1| hypothetical protein CLIBASIA_02310 [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 628 bits (1620), Expect = 0.0, Method: Compositional matrix adjust. Identities = 316/316 (100%), Positives = 316/316 (100%) Query: 1 MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRV 60 MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRV Sbjct: 1 MGKGATKKEYSKGLSKENASLPTMMGTLFVFCAYILWGITPLYTQFLEQVSVLEVISHRV 60 Query: 61 LWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLT 120 LWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLT Sbjct: 61 LWSLPGVFFAIVYFSGGLSLLKDTLKNPKAVGMLVFSATILAVHWGFFIYALLTRQGFLT 120 Query: 121 SFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSA 180 SFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSA Sbjct: 121 SFSYFVTPVISVFLGSVFLKERLNHLQIIAALLIILSLLIMTLHSGIPLLSLAIAVTWSA 180 Query: 181 YCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLN 240 YCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLN Sbjct: 181 YCFARKTIPVGSSEGFFIEMCVLAIPALFYVVWNGFSGGEHFFLGNIPDTLFLIGYGLLN 240 Query: 241 SFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVY 300 SFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVY Sbjct: 241 SFVFCIFSYGIKRAKLSTVGIMEYTAPLLMIVSSVFILKQPIDTVRTIVFGIVVIAMVVY 300 Query: 301 LLPTVINSGKNKTKKS 316 LLPTVINSGKNKTKKS Sbjct: 301 LLPTVINSGKNKTKKS 316 >gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 23.1 bits (48), Expect = 5.9, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Query: 38 GITPLYTQFLEQVSVLEVISHRVLWSL 64 G+TP + FLE++S++ V H+V+ +L Sbjct: 44 GLTPRF--FLEELSIINVDWHKVVVTL 68 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.143 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 196,172 Number of Sequences: 1233 Number of extensions: 8047 Number of successful extensions: 22 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 9 length of query: 316 length of database: 328,796 effective HSP length: 74 effective length of query: 242 effective length of database: 237,554 effective search space: 57488068 effective search space used: 57488068 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 38 (19.2 bits)