BLAST/PSIBLAST alignment of GI: 254780576 and GI: 222148100 at iteration 1
>gi|222148100|ref|YP_002549057.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 628
>gi|221735088|gb|ACM36051.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 628
 Score =  628 bits (1620), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 284/588 (48%), Positives = 407/588 (69%)

Query: 10  RTLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKTT 69
           RT+  LWPYMWPA R DLK+R++ A   ++ +K V++ +P+  KW T++L  +  A+   
Sbjct: 17  RTIVNLWPYMWPAERLDLKMRVVWASLFLVIAKLVLMLVPYYFKWATDALNGKMDATGLL 76

Query: 70  SYLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHI 129
               +  V+L+ +Y   R+V +  N  RD L+  +GQ A   L H    H+++LS RFH+
Sbjct: 77  PAFMLSAVMLVIAYNLARIVQMGINQFRDALFASVGQYAVRRLAHITFLHMHQLSLRFHL 136

Query: 130 NYKVGKLSSAISNGIRSIEMIIRIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMAVTVI 189
             K G LS  I  G + IE I+R  +++ IPT++EFA++    W+ YG  Y++I AVTV 
Sbjct: 137 ERKTGGLSRIIERGTKGIETIVRFTILNSIPTLIEFALTAVIFWWGYGFSYLAITAVTVA 196

Query: 190 LYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFEINRLEKYISK 249
           +YVWFT+  S+WR+ + + MN+   + + K  D+L+NFET++YF +E  E  R +  +++
Sbjct: 197 VYVWFTVKASDWRIAIRRAMNDSDTDANVKAIDSLLNFETVKYFGNEDMEARRFDASMAR 256

Query: 250 YKESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFINTLLTQLAI 309
           Y+++A  V TSLGWLNFGQGLIF +GM + ++ S+ AV  GEQT+GDFVF+N LL QL++
Sbjct: 257 YEKAATQVWTSLGWLNFGQGLIFGVGMTVMLVFSALAVQRGEQTIGDFVFVNALLLQLSV 316

Query: 310 PLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVFNNVSFSYNHH 369
           PLN +G +YR+ RQ   +IE++ ++L  + E+++A ++K L I  G I F NV F+Y+  
Sbjct: 317 PLNFIGMLYREIRQGLTDIEQMFDLLAVEPEVRDAPDAKPLAIAKGAITFENVHFAYDPA 376

Query: 370 NCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESL 429
             I KGISF +   K  A++G SG GKST+++LLYR YD++ G I IDGQD++ IT+ SL
Sbjct: 377 RPILKGISFTVPEGKTVAVVGPSGAGKSTISRLLYRFYDVQQGAIRIDGQDVRDITQTSL 436

Query: 430 RQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGE 489
           R  IG++PQDT+LFNDT+ YNI YG P ASD E+ AA ++AQ+   I +LP GY T+VGE
Sbjct: 437 RAAIGMVPQDTVLFNDTIAYNIRYGRPEASDAEMEAAADIAQISRSIRELPQGYKTMVGE 496

Query: 490 RGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIA 549
           RGLKLSGGEKQRV+IAR +LK+PPI+I DEATS+LD  TE+ IQ AL  +S+NRTTLVIA
Sbjct: 497 RGLKLSGGEKQRVAIARTVLKSPPILILDEATSALDTTTEQDIQAALDIVSQNRTTLVIA 556

Query: 550 HRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQCESIK 597
           HRLST+  AD IIV   G + E G+H  L++Q G+Y SMW +Q E+ +
Sbjct: 557 HRLSTVIGADEIIVLKAGEIAERGTHAELLAQNGLYASMWNRQREATQ 604