BLAST/PSIBLAST alignment of GI: 254780576 and GI: 315121769 at iteration 1
>gi|315121769|ref|YP_004062258.1| ABC transporter related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 598
>gi|313495171|gb|ADR51770.1| ABC transporter related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 598
 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/596 (72%), Positives = 520/596 (87%)

Query: 1   MAFARFPSLRTLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLI 60
           MAF+RF SL+ LK LWPYMWP +R DLKVRIIGAM  +IASKFV+L IPFL KW+TESLI
Sbjct: 1   MAFSRFSSLKILKNLWPYMWPKDRLDLKVRIIGAMIFLIASKFVLLSIPFLFKWITESLI 60

Query: 61  EQSTASKTTSYLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHV 120
           ++S  SK   YL +GI ILI +YG MR++NLI N IRD  + ++GQ ATCTLY++VVSHV
Sbjct: 61  DKSIFSKNVHYLVMGIPILIIAYGAMRILNLILNQIRDVFFAKVGQSATCTLYYKVVSHV 120

Query: 121 YKLSQRFHINYKVGKLSSAISNGIRSIEMIIRIIVVHLIPTILEFAISMAFLWYSYGDIY 180
           YKLSQRFHI+YKVGKLSSAISNG +S+E IIRI++VHLIPTILEF +S+AFLW+SYG  Y
Sbjct: 121 YKLSQRFHIDYKVGKLSSAISNGTKSMETIIRIMMVHLIPTILEFFVSIAFLWHSYGLFY 180

Query: 181 VSIMAVTVILYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFEI 240
           VS++A  VI+YVWFT++TSNWRV L ++ N+LLHECHAKVFD+LINFET+QY+N+EK EI
Sbjct: 181 VSVIACIVIIYVWFTVVTSNWRVTLFRETNHLLHECHAKVFDSLINFETMQYYNAEKAEI 240

Query: 241 NRLEKYISKYKESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFI 300
            + +KY+ KY++SAIS++ SLGWLNFGQG IFSIGMVI MI+SSHA+Y G QT+GDF+FI
Sbjct: 241 TKFKKYMEKYEKSAISISNSLGWLNFGQGFIFSIGMVIIMIMSSHAIYAGTQTIGDFIFI 300

Query: 301 NTLLTQLAIPLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVFN 360
           NTLL+QL++PLNI+GTIYRDSRQSFIEIEEL NIL+E+IE+++A N++ LKIKNG I F+
Sbjct: 301 NTLLSQLSLPLNIIGTIYRDSRQSFIEIEELFNILDERIEVEDAPNAQALKIKNGDITFD 360

Query: 361 NVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQD 420
           NV FSYN +N I KG+SF+I+P KKTALIG+SGVGKST++KLLYRLYDI+ G I ID QD
Sbjct: 361 NVFFSYNPNNDILKGVSFKISPGKKTALIGKSGVGKSTISKLLYRLYDIQSGSIKIDSQD 420

Query: 421 IKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLP 480
           I+K+T+ESLRQ IGIIPQ+TILFNDTLRYNILY  P+AS++EL +AVE+AQLKSFIM LP
Sbjct: 421 IQKVTRESLRQNIGIIPQETILFNDTLRYNILYSKPDASEEELFSAVEIAQLKSFIMNLP 480

Query: 481 NGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLS 540
           +GYDT+VGERGLKLSGGEKQRVSIARAILKNP I+IFDEATSSLD ITER IQ  L  LS
Sbjct: 481 DGYDTIVGERGLKLSGGEKQRVSIARAILKNPSIMIFDEATSSLDTITERQIQKELDLLS 540

Query: 541 KNRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQCESI 596
           +NRTTL+IAHRLSTI +AD IIV ++G V E GSHE+LIS+GGIY++MWKKQ ES+
Sbjct: 541 ENRTTLMIAHRLSTIVNADTIIVLNKGRVAEHGSHEDLISRGGIYSAMWKKQKESL 596