BLAST/PSIBLAST alignment of GI: 254780576 and GI: 86357053 at iteration 1
>gi|86357053|ref|YP_468945.1| putative ABC transporter, ATP-binding protein [Rhizobium etli CFN 42] Length = 625
>gi|86281155|gb|ABC90218.1| putative ABC transporter, ATP-binding protein [Rhizobium etli CFN 42] Length = 625
 Score =  629 bits (1621), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 289/589 (49%), Positives = 410/589 (69%)

Query: 9   LRTLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKT 68
           LRTL  LWPYMWPA R DLK+R+I A   ++ SKFV+L +P+  KW T++L  +   +  
Sbjct: 13  LRTLFNLWPYMWPAGRTDLKMRVIWASVFLLVSKFVLLLVPYFFKWSTDALNGRMDLAGA 72

Query: 69  TSYLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFH 128
              L  G + L+ +Y   R++ L  N +RD L+  +GQ A   L ++   H+++LS RFH
Sbjct: 73  VPPLLAGAIALVIAYNVTRLIQLGLNQLRDALFASVGQHAVRQLAYKTFVHMHELSLRFH 132

Query: 129 INYKVGKLSSAISNGIRSIEMIIRIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMAVTV 188
           +  K G LS  I  G + IE I+R  +++ +PT++EF ++    W+ YG  Y+++   TV
Sbjct: 133 LERKTGGLSRIIERGTKGIETIVRFTILNSVPTVIEFLLTAVIFWWGYGFSYLAVTGFTV 192

Query: 189 ILYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFEINRLEKYIS 248
             Y+WFTI  S+WR+ + + MN+   + + K  D+L+NFET++YF +E+ E  R +K + 
Sbjct: 193 WAYIWFTIRASDWRIAIRRSMNDSDTDANTKAIDSLLNFETVKYFGNEEMEAKRFDKSME 252

Query: 249 KYKESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFINTLLTQLA 308
           +Y+++A  V TSLGWLNFGQG+IF IG  I +++S+ AV  GEQTVGDFVF+N++L QL+
Sbjct: 253 RYEKAATDVWTSLGWLNFGQGVIFGIGTTIMLVLSALAVQRGEQTVGDFVFVNSMLLQLS 312

Query: 309 IPLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVFNNVSFSYNH 368
           +PLN +G +YR+ RQ   +IE++ ++L  K E+++A ++ +L I  G I F +V F+Y+ 
Sbjct: 313 VPLNFIGFVYREIRQGLTDIEQMFDLLEVKAEVKDAPDAAELGIGKGAISFKDVHFAYDP 372

Query: 369 HNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKES 428
              I KGISF++   K  A++G SG GKST+++LLYR YDI+ G ITIDGQDI+ +T++S
Sbjct: 373 ARPILKGISFDVPAGKTVAVVGPSGAGKSTLSRLLYRFYDIQSGAITIDGQDIRTVTQKS 432

Query: 429 LRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVG 488
           LR  IG++PQDT+LFNDT+ YNI YG  +ASD E+ AA EVAQ+  FI  LP G++T VG
Sbjct: 433 LRSLIGMVPQDTVLFNDTVAYNIRYGRTSASDDEIYAAAEVAQIAHFIEMLPEGFETKVG 492

Query: 489 ERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVI 548
           ERGLKLSGGEKQRV+IAR +LK PPI+I DEATS+LD  TER IQTAL  +SKNRTTLVI
Sbjct: 493 ERGLKLSGGEKQRVAIARTVLKAPPILILDEATSALDTTTEREIQTALDVVSKNRTTLVI 552

Query: 549 AHRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQCESIK 597
           AHRLST+  AD IIV   G + E G+H  L+ + G+Y SMW +Q E+ +
Sbjct: 553 AHRLSTVIGADEIIVLKSGEIAERGTHAALLERNGLYASMWNRQREATQ 601