RPSBLAST alignment for GI: 254780576 and conserved domain: TIGR01257

>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter. This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. Length = 2272
 Score = 75.4 bits (185), Expect = 3e-14
 Identities = 57/195 (29%), Positives = 97/195 (49%), Gaps = 10/195 (5%)

Query: 383  SKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTIL 442
            ++ TA +G +G GK+T   +L  L     G + + G+DI+    +++RQ++G+ PQ  IL
Sbjct: 956  NQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIET-NLDAVRQSLGMCPQHNIL 1014

Query: 443  FND-TLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQR 501
            F+  T+  +IL+       Q    + E AQL+   M    G      E    LSGG +++
Sbjct: 1015 FHHLTVAEHILF-----YAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRK 1069

Query: 502  VSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLSTITD--AD 559
            +S+A A + +  +++ DE TS +D  + R I   L      RT ++  H +    D   D
Sbjct: 1070 LSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHMDE-ADLLGD 1128

Query: 560  NIIVFDQGTVVESGS 574
             I +  QG +  SG+
Sbjct: 1129 RIAIISQGRLYCSGT 1143