RPSBLAST alignment for GI: 254780576 and conserved domain: TIGR02203

>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. Length = 571
 Score =  307 bits (788), Expect = 5e-84
 Identities = 174/595 (29%), Positives = 290/595 (48%), Gaps = 40/595 (6%)

Query: 11  TLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASK--T 68
           T ++LW Y+ P  +  L +  + AM  V A++  +  +   LK + +        S    
Sbjct: 1   TFRRLWSYVRPY-KAGLVLAGV-AMILVAATESTLAAL---LKPLLDDGFGGRDRSVLWW 55

Query: 69  TSYLTIGIVIL--ITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQR 126
              + IG+ +L  I S+ +  +++ +SN +   + V             +   +  L   
Sbjct: 56  VPLVVIGLAVLRGICSFVSTYLLSWVSNKVVRDIRVR------------MFEKLLGLPVS 103

Query: 127 FHINYKVGKLSSAISNGI-RSIEMIIRIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMA 185
           F      G L S I+    +         +V +  T+    + +  L+YS+         
Sbjct: 104 FFDRQPTGTLLSRITFDSEQVASAATDAFIVLVRETLTVIGLFIVLLYYSW--------Q 155

Query: 186 VTVILYVWFTIITSNWRV------GLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFE 239
           +T+I+ V   +++   R        +SK++ N + +      +TL  +  ++ F  + +E
Sbjct: 156 LTLIVVVMLPVLSILMRRVSKRLRRISKEIQNSMGQVTTVAEETLQGYRVVKLFGGQAYE 215

Query: 240 INRLEKYISKYKESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVF 299
             R +   ++ +  A+ + ++    +    LI S+ + + + I+      G  T GDF  
Sbjct: 216 TRRFDAVSNRNRRLAMKMTSAGSISSPITQLIASLALAVVLFIALFQAQAGSLTAGDFTA 275

Query: 300 INTLLTQLAIPLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVF 359
             T +  L  PL  L  +    ++     E L  +L+   E      ++ ++   G + F
Sbjct: 276 FITAMIALIRPLKSLTNVNAPMQRGLAAAESLFTLLDSPPEKDTG--TRAIERARGDVEF 333

Query: 360 NNVSFSYNHHNC-IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDG 418
            NV+F Y   +      IS  I P +  AL+G SG GKST+  L+ R Y+   G I +DG
Sbjct: 334 RNVTFRYPGRDRPALDSISLVIEPGETVALVGRSGSGKSTLVNLIPRFYEPDSGQILLDG 393

Query: 419 QDIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNP-NASDQELCAAVEVAQLKSFIM 477
            D+   T  SLR+ + ++ QD +LFNDT+  NI YG    A   E+  A+  A  + F+ 
Sbjct: 394 HDLADYTLASLRRQVALVSQDVVLFNDTIANNIAYGRTEQADRAEIERALAAAYAQDFVD 453

Query: 478 KLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALA 537
           KLP G DT +GE G+ LSGG++QR++IARA+LK+ PI+I DEATS+LD  +ER +Q AL 
Sbjct: 454 KLPLGLDTPIGENGVLLSGGQRQRLAIARALLKDAPILILDEATSALDNESERLVQAALE 513

Query: 538 TLSKNRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQ 592
            L + RTTLVIAHRLSTI  AD I+V D G +VE G+H  L+++ G+Y  +   Q
Sbjct: 514 RLMQGRTTLVIAHRLSTIEKADRIVVMDDGRIVERGTHNELLARNGLYAQLHNMQ 568