RPSBLAST alignment for GI: 254780576 and conserved domain: TIGR03005

>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins. Length = 252
 Score = 96.4 bits (240), Expect = 2e-20
 Identities = 69/250 (27%), Positives = 121/250 (48%), Gaps = 38/250 (15%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           + F++V+  +     +  G++F +A  +K ALIG SG GKST+ ++L  L  I  G I +
Sbjct: 1   VRFSDVTKRFGILTVL-DGLNFSVAAGEKVALIGPSGSGKSTILRILMTLEPIDEGQIQV 59

Query: 417 DGQ---------------DIKKITKESLRQTIGII-------PQDTILFNDTLRYNILYG 454
           +G+               D K + +  +R  IG++       P  T+L N T    ++ G
Sbjct: 60  EGEQLYHMPGRNGPLVPADEKHLRQ--MRNKIGMVFQSFNLFPHKTVLDNVTEAPVLVLG 117

Query: 455 NPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPI 514
              A  ++   A+E+  +     K  +           +LSGG++QRV+IARA+   P +
Sbjct: 118 MARAEAEK--RAMELLDMVGLADKADH--------MPAQLSGGQQQRVAIARALAMRPKV 167

Query: 515 IIFDEATSSLDIITERHIQTALATLSK--NRTTLVIAHRLSTITD-ADNIIVFDQGTVVE 571
           ++FDE TS+LD      +   +  L+   + T L++ H +    + AD +  FD+G +VE
Sbjct: 168 MLFDEVTSALDPELVGEVLNVIRRLASEHDLTMLLVTHEMGFAREFADRVCFFDKGRIVE 227

Query: 572 SGSHENLISQ 581
            G  + +  Q
Sbjct: 228 QGKPDEIFRQ 237