RPSBLAST alignment for GI: 254780576 and conserved domain: TIGR00958

>gnl|CDD|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein. Length = 711
 Score =  245 bits (628), Expect = 2e-65
 Identities = 140/432 (32%), Positives = 231/432 (53%), Gaps = 24/432 (5%)

Query: 168 SMAF-LWYSYGDIYVSIMAVTVILYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLIN 226
            + F LW S     V+++ + ++       +       LS+++   + + +    + L  
Sbjct: 292 LLGFMLWLSPRLTMVTLINLPLVFLA--EKVFGKRYQLLSEELQEAVAKANQVAEEALSG 349

Query: 227 FETIQYFNSEKFEINR----LEKYISKYKESAISVATSLGWLN--FGQGLIFSIGMVITM 280
             T++ F +E+ E +R    LE+ +   K  A++ A  L W     G  +      V+ +
Sbjct: 350 MRTVRSFAAEEGEASRFKEALEETLQLNKRKALAYAGYL-WTTSVLGMLIQ-----VLVL 403

Query: 281 IISSHAVYIGEQTVGDFVFINTLLTQLAIPLNI--LGTIYRDSRQSFIEIEELLNILNEK 338
                 V  G+ + G+ V  + LL Q  +   +  L  +Y    Q+    E++   L+ K
Sbjct: 404 YYGGQLVLTGKVSSGNLV--SFLLYQEQLGEAVRVLSYVYSGMMQAVGASEKVFEYLDRK 461

Query: 339 IEIQNAVNSKDLKIKNGHIVFNNVSFSYNHH--NCIFKGISFEIAPSKKTALIGESGVGK 396
             I        L ++ G I F +VSFSY +     + KG++F + P +  AL+G SG GK
Sbjct: 462 PNIPLTGTLAPLNLE-GLIEFQDVSFSYPNRPDVPVLKGLTFTLHPGEVVALVGPSGSGK 520

Query: 397 STVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNP 456
           STVA LL  LY   GG + +DG  + +     L + + ++ Q+ +LF+ ++R NI YG  
Sbjct: 521 STVAALLQNLYQPTGGQVLLDGVPLVQYDHHYLHRQVALVGQEPVLFSGSVRENIAYGLT 580

Query: 457 NASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIII 516
           +  D+E+ AA + A    FIM+ PNGYDT VGE+G +LSGG+KQR++IARA+++ P ++I
Sbjct: 581 DTPDEEIMAAAKAANAHDFIMEFPNGYDTEVGEKGSQLSGGQKQRIAIARALVRKPRVLI 640

Query: 517 FDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHE 576
            DEATS+LD   E+ +Q + +    +RT L+IAHRLST+  AD I+V  +G+VVE G+H+
Sbjct: 641 LDEATSALDAECEQLLQESRS--RASRTVLLIAHRLSTVERADQILVLKKGSVVEMGTHK 698

Query: 577 NLISQGGIYTSM 588
            L+   G Y  +
Sbjct: 699 QLMEDQGCYKHL 710