RPSBLAST alignment for GI: 254780576 and conserved domain: TIGR01271

>gnl|CDD|162277 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR). The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se. Length = 1490
 Score =  100 bits (250), Expect = 1e-21
 Identities = 126/547 (23%), Positives = 237/547 (43%), Gaps = 74/547 (13%)

Query: 71  YLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHIN 130
           YL +G+ +L        +V  +  H   F    +G      L+  +     KLS R    
Sbjct: 123 YLALGLCLLF-------IVRTLLLHPAIFGLHHLGMQMRIALFSLIYKKTLKLSSRVLDK 175

Query: 131 YKVGKLSSAISNGIRSIEMIIRIIVVHLI-PTILEFAISMAFLWYSYGDIYVSIMAVTVI 189
              G+L S +SN +   +    + + H +    L+  + M  +W         ++ V   
Sbjct: 176 ISTGQLVSLLSNNLNKFDE--GLALAHFVWIAPLQVILLMGLIW--------ELLEVNGF 225

Query: 190 LYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTL-INFETIQYFNSEK---FEINRLEK 245
             + F I+ + ++  L +KM     +   K+ + L I  E I+   S K   +E   +EK
Sbjct: 226 CGLGFLILLALFQACLGQKMMPYRDKRAGKISERLAITSEIIENIQSVKAYCWE-EAMEK 284

Query: 246 YISKYKESAISVATSLGWLNF--GQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFIN-T 302
            I   ++  + +   + +L +       FS   V+ + +  +A+  G      F  I+  
Sbjct: 285 IIKNIRQDELKLTRKIAYLRYFYSSAFFFSGFFVVFLSVVPYALIKGIILRRIFTTISYC 344

Query: 303 LLTQLAIPLNILGTI--YRDSRQSFIEIEELL----------NILNEKIEIQNAV----- 345
           ++ ++ +     G I  + DS  +  +I++ L          N+   ++E+ N       
Sbjct: 345 IVLRMTVTRQFPGAIQTWYDSLGAITKIQDFLCKEEYKTLEYNLTTTEVEMVNVTASWDE 404

Query: 346 -----------NSKDLKIKNGH--IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGES 392
                      N+K  K  NG   + F+N S    +   + K ISF++   +  A+ G +
Sbjct: 405 GIGELFEKIKQNNKARKQPNGDDGLFFSNFSL---YVTPVLKNISFKLEKGQLLAVAGST 461

Query: 393 GVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYNIL 452
           G GKS++      L  I G +   +G    KI K S R  I   PQ + +   T++ NI+
Sbjct: 462 GSGKSSL------LMMIMGELEPSEG----KI-KHSGR--ISFSPQTSWIMPGTIKDNII 508

Query: 453 YGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNP 512
           +G  +  +    + ++  QL+  I   P    TV+GE G+ LSGG++ R+S+ARA+ K+ 
Sbjct: 509 FG-LSYDEYRYTSVIKACQLEEDIALFPEKDKTVLGEGGITLSGGQRARISLARAVYKDA 567

Query: 513 PIIIFDEATSSLDIITERHI-QTALATLSKNRTTLVIAHRLSTITDADNIIVFDQGTVVE 571
            + + D   + LD++TE+ I ++ L  L  N+T +++  +L  +  AD I++  +G    
Sbjct: 568 DLYLLDSPFTHLDVVTEKEIFESCLCKLMSNKTRILVTSKLEHLKKADKILLLHEGVCYF 627

Query: 572 SGSHENL 578
            G+   L
Sbjct: 628 YGTFSEL 634