RPSBLAST alignment for GI: 254780576 and conserved domain: PRK13652

>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 277
 Score = 87.9 bits (218), Expect = 7e-18
 Identities = 68/233 (29%), Positives = 114/233 (48%), Gaps = 24/233 (10%)

Query: 361 NVSFSYNHHNCIFKGISFEIAPSK-KTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQ 419
           ++ +SY+        I+F IAP   + A+IG +G GKST+ +    +     G + I G+
Sbjct: 8   DLCYSYSGSKEALNNINF-IAPRNSRIAVIGPNGAGKSTLFRHFNGILKPTSGSVLIRGE 66

Query: 420 DIKKITKESLRQTIGIIPQ--DTILFNDTLRYNILYGNPNAS-DQELCA-----AVEVAQ 471
            I K     +R+ +G++ Q  D  +F+ T+  +I +G  N   D+E  A     A+ +  
Sbjct: 67  PITKENIREVRKFVGLVFQNPDDQIFSPTVEQDIAFGPINLGLDEETVAHRVSSALHMLG 126

Query: 472 LKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERH 531
           L+    ++P+            LSGGEK+RV+IA  I   P +++ DE T+ LD    + 
Sbjct: 127 LEELRDRVPH-----------HLSGGEKKRVAIAGVIAMEPQVLVLDEPTAGLDPQGVKE 175

Query: 532 IQTALATLSKNRTTLVI--AHRLSTITD-ADNIIVFDQGTVVESGSHENLISQ 581
           +   L  L +     VI   H+L  + + AD I V D+G +V  G+ E +  Q
Sbjct: 176 LIDFLNDLPETYGMTVIFSTHQLDLVPEMADYIYVMDKGRIVAYGTVEEIFLQ 228