RPSBLAST alignment for GI: 254780576 and conserved domain: PRK14255

>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional. Length = 252
 Score = 93.5 bits (232), Expect = 1e-19
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 20/213 (9%)

Query: 373 FKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYD-IKGGIIT----IDGQDI--KKIT 425
            KGI  +   ++ TALIG SG GKST  + L R+ D I G  IT    + GQ+I      
Sbjct: 21  LKGIDLDFNQNEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGNVSLRGQNIYAPNED 80

Query: 426 KESLRQTIGIIPQDTILFNDTLRYNILYG---NPNASDQELCAAVEVAQLKSFIMKLPNG 482
              LR+ +G++ Q    F  ++  N++YG           L  AVE +      +K    
Sbjct: 81  VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGVKDKAVLDEAVETS------LKQAAI 134

Query: 483 YDTV---VGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATL 539
           +D V   + E  L LSGG++QRV IAR +   P +I+ DE TS+LD I+   I+  L  L
Sbjct: 135 WDEVKDHLHESALSLSGGQQQRVCIARVLAVKPDVILLDEPTSALDPISSTQIENMLLEL 194

Query: 540 SKNRTTLVIAHRLSTITD-ADNIIVFDQGTVVE 571
               T +++ H +   +  +D    F  G ++E
Sbjct: 195 RDQYTIILVTHSMHQASRISDKTAFFLTGNLIE 227