RPSBLAST alignment for GI: 254780576 and conserved domain: PRK14256

>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional. Length = 252
 Score = 85.8 bits (212), Expect = 3e-17
 Identities = 75/249 (30%), Positives = 120/249 (48%), Gaps = 30/249 (12%)

Query: 361 NVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIK-----GGIIT 415
           NV F  NH     K +S +   +  TA+IG SG GKSTV + + R++D+       G I 
Sbjct: 11  NVHFGKNH---AVKDVSMDFPENSVTAIIGPSGCGKSTVLRSINRMHDLVPSARVTGKIL 67

Query: 416 IDGQDI--KKITKESLRQTIGIIPQDTILFNDTLRY-NILYG---NPNASDQELCAAVEV 469
           +D  DI  + +   S+R+ +G++ Q    F     Y N++ G   N   +  E    VE 
Sbjct: 68  LDDTDIYDRGVDPVSIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRVNRSEADEIVE- 126

Query: 470 AQLKSFIMKLPNGYDTV---VGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDI 526
           + LK   +     +D V   +    ++LSGG++QR+ IAR I   P +I+ DE  S+LD 
Sbjct: 127 SSLKRVAL-----WDEVKDRLKSNAMELSGGQQQRLCIARTIAVKPEVILMDEPASALDP 181

Query: 527 ITERHIQTALATLSKNRTTLVIAHRLSTITD-ADNIIVFDQGTVVESGSHENLISQGGIY 585
           I+   I+  +  L +  T +++ H +      +D    F  G +VE G  +       I+
Sbjct: 182 ISTLKIEELIEELKEKYTIIIVTHNMQQAARVSDYTAFFYMGDLVECGETKK------IF 235

Query: 586 TSMWKKQCE 594
           T+  KKQ E
Sbjct: 236 TTPEKKQTE 244