RPSBLAST alignment for GI: 254780576 and conserved domain: PRK14260

>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional. Length = 259
 Score = 93.9 bits (233), Expect = 1e-19
 Identities = 75/243 (30%), Positives = 120/243 (49%), Gaps = 26/243 (10%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKG----- 411
           I   ++SF YN    I +GIS +I  +K TA+IG SG GKST  K L R+ +++G     
Sbjct: 8   IKVKDLSFYYNTSKAI-EGISMDIYRNKVTAIIGPSGCGKSTFIKTLNRISELEGPVKVE 66

Query: 412 GIITIDGQDI--KKITKESLRQTIGIIPQDTILFNDTLRYNILYG---NPNASDQELCAA 466
           G++   GQ+I   +I    LR+ IG++ Q    F  ++  N+ YG   +      +L   
Sbjct: 67  GVVDFFGQNIYDPRININRLRRQIGMVFQRPNPFPMSIYENVAYGVRISAKLPQADLDEI 126

Query: 467 VEVAQLKSFIMKLPNGYDTV---VGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSS 523
           VE A LK   +     +  V   + +  L LSGG++QR+ IARA+   P +++ DE  S+
Sbjct: 127 VESA-LKGAAL-----WQEVKDKLNKSALGLSGGQQQRLCIARALAIKPKVLLMDEPCSA 180

Query: 524 LDIITERHIQTALATLSKNRTTLVIAHRLSTITDADNIIVF---DQ---GTVVESGSHEN 577
           LD I    ++  + +L    T  ++ H +   T   +   F   D+   G +VE G    
Sbjct: 181 LDPIATMKVEELIHSLRSELTIAIVTHNMQQATRVSDFTAFFSTDESRIGQMVEFGVTTQ 240

Query: 578 LIS 580
           + S
Sbjct: 241 IFS 243