RPSBLAST alignment for GI: 254780576 and conserved domain: CHL00131

>gnl|CDD|177053 CHL00131, ycf16, sulfate ABC transporter protein; Validated. Length = 252
 Score = 64.7 bits (158), Expect = 7e-11
 Identities = 71/253 (28%), Positives = 107/253 (42%), Gaps = 41/253 (16%)

Query: 346 NSKDLKIKNGHIVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLL-- 403
           N   L+IKN H   N         N I KG++  I   +  A++G +G GKST++K++  
Sbjct: 4   NKPILEIKNLHASVNE--------NEILKGLNLSINKGEIHAIMGPNGSGKSTLSKVIAG 55

Query: 404 YRLYDIKGGIITIDGQDIKKITKESLRQTIGI---------IPQDTILFN-DTLR--YN- 450
           +  Y I  G I   G+ I  +  E  R  +GI         IP  +   N D LR  YN 
Sbjct: 56  HPAYKILEGDILFKGESILDLEPE-ERAHLGIFLAFQYPIEIPGVS---NADFLRLAYNS 111

Query: 451 --ILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLK--LSGGEKQRVSIAR 506
                G P          +E  ++ +  +KL    D     R +    SGGEK+R  I +
Sbjct: 112 KRKFQGLPELD------PLEFLEIINEKLKLVG-MDPSFLSRNVNEGFSGGEKKRNEILQ 164

Query: 507 AILKNPPIIIFDEATSSLDIITERHIQTALATLS-KNRTTLVIAH--RLSTITDADNIIV 563
             L +  + I DE  S LDI   + I   +  L     + ++I H  RL      D + V
Sbjct: 165 MALLDSELAILDETDSGLDIDALKIIAEGINKLMTSENSIILITHYQRLLDYIKPDYVHV 224

Query: 564 FDQGTVVESGSHE 576
              G ++++G  E
Sbjct: 225 MQNGKIIKTGDAE 237