RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11124

>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional. Length = 242
 Score = 72.4 bits (178), Expect = 3e-13
 Identities = 62/236 (26%), Positives = 111/236 (47%), Gaps = 28/236 (11%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           I  N ++  Y  H  +F  I+ +    +   L+G SG GKS++ ++L  L   + G + I
Sbjct: 3   IQLNGINCFYGAHQALFD-ITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNI 61

Query: 417 DGQ--DIKKITKE----SLRQTIGIIPQDTILF-NDTLRYN-------ILYGNPNASDQE 462
            G   D  K   +     LR+ +G++ Q   L+ + T++ N       +L  + + +   
Sbjct: 62  AGNHFDFSKTPSDKAIRELRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALAR 121

Query: 463 LCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATS 522
               +E  +LK +  + P           L LSGG++QRV+IARA++  P +++FDE T+
Sbjct: 122 AEKLLERLRLKPYADRFP-----------LHLSGGQQQRVAIARALMMEPQVLLFDEPTA 170

Query: 523 SLDIITERHIQTALATLSKNRTTLVI-AHRLSTITD-ADNIIVFDQGTVVESGSHE 576
           +LD      I + +  L++   T VI  H +      A  ++  + G +VE G   
Sbjct: 171 ALDPEITAQIVSIIRELAETGITQVIVTHEVEVARKTASRVVYMENGHIVEQGDAS 226