RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11144

>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional. Length = 352
 Score = 84.9 bits (211), Expect = 5e-17
 Identities = 66/209 (31%), Positives = 101/209 (48%), Gaps = 37/209 (17%)

Query: 386 TALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQ---DI-KKITKESLRQTIGIIPQDTI 441
           TA+ G SG GK+++   +  L   + G I ++G+   D  K I     ++ IG + QD  
Sbjct: 27  TAIFGRSGAGKTSLINAISGLTRPQKGRIVLNGRVLFDAEKGICLPPEKRRIGYVFQDAR 86

Query: 442 LF-NDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLK------- 493
           LF +  +R N+ YG          A   VAQ           +D +V   G++       
Sbjct: 87  LFPHYKVRGNLRYG---------MAKSMVAQ-----------FDKIVALLGIEPLLDRYP 126

Query: 494 --LSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK--NRTTLVIA 549
             LSGGEKQRV+I RA+L  P +++ DE  +SLD+  +R +   L  L++  N   L ++
Sbjct: 127 GSLSGGEKQRVAIGRALLTAPELLLMDEPLASLDLPRKRELLPYLERLAREINIPILYVS 186

Query: 550 HRLSTITD-ADNIIVFDQGTVVESGSHEN 577
           H L  I   AD ++V +QG V   G  E 
Sbjct: 187 HSLDEILRLADRVVVLEQGKVKAFGPLEE 215